amateur censored high vision creampie uniform




FC2ATIDBBANABWJUFEHZGDAWDAUKSHNDLULUDTTGMEMROYDMEYDPREDNATRMIAAMVSDCESDWAAASDAB

2022-02-20
120 min

[SPZ-1123]Convincing Cute Amateur Girls With Money - Negotiating To Give Them Raw Creampies - Voyeur Videos

  • censoredcreampiesquirtingSPZstar paradisestar paradiesSPZ-1123SPZ1123h-254spz01123
    • 2022-02-19
    232 min

    [ROOM-035]S********ls For Rent: A, B, Or C - Which Cup Size Is Your Favorite？

  • censoredcreampieuniformROOMhomeroom daydream tribehomeroom homeroom daydream tribeROOM-035ROOM035room00035
    • 2022-02-11
    141 min

    [BANK-071]Beautiful Amateur Girl & Uncut Creampie Footage! This Light Skinned S********l Has Been Shy Her Whole Life Kana Yagi

  • yagi hanana censoredcreampieuniformBANKpussy banktake chanBANK-071BANK071h-1495bank00071
    • 2022-02-03
    118 min

    [STSK-016]I Will Sell My Dear Friend 2

  • censoredcreampieuniformSTSKamateur 39STSK-016STSK016h-1605stsk00016
    • 2022-01-08
    163 min

    [SABA-743]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn"t Resist Her... vol. 015

  • censoredcreampieuniformSABAskyu shirototodoSABA-743SABA743saba00743
    • 2022-01-06
    106 min

    [STSK-012]隣人盗撮♯2 ～J○2名・17登校・部屋9日～

  • censoredcreampieuniformSTSKshirouto 39STSK-012STSK012h-1605stsk00012
    • 2021-12-02
    238 min

    [STSK-005]Going Undercover To A Physical J* Uniform Reflexology Salon An All Peeping Expose Of The Truth Behind Their Secret Optional Services *4 Girls On Film*

  • censoredcreampieuniformSTSKshirouto 39STSK-005STSK005h-1605stsk00005
    • 2021-11-26
    216 min

    [SKMJ-230]This Innocent Sch**lgirl Is Inserting Three Fingers Into Her Pussy And Filming Herself In A Dripping Masturbation Session! Immediately After Cumming, She Gets A Big Dick Slammed Into That Wet P*ssy For Some Quickie Fucking! "Nooooo! I J

  • censoredcreampieuniformSKMJred face girlone topSKMJ-230SKMJ230h-1324skmj00230
    • 2021-09-24
    237 min

    [SKMJ-210]Amateur Sch**lgirls In A Real Pickup! Male And Female S*****t Boys And Girls Are Out On The Street, And Taking The "If You Can Extract 20ml Of Semen, You"ll Win 100,000 Yen Variety Special" Challenge! She"s Blushing Like A T

  • censoredcreampiebig titsSKMJsekimenjoshikikufukusekimen goshiSKMJ-210SKMJ210h-1324skmj00210
    • 2021-08-13
    149 min

    [BANK-049]Uncut Creampie Shoot With Beautiful Amateur Girl! Unparalleled Shaved Pussy Slender Hottie Business Woman

  • censoredcreampieuniformBANKma ko ginkoutakechanBANK-049BANK049h-1495bank00049
    • 2021-07-08
    189 min

    [SVDVD-867]Slutty Challengers Try To Squat on Thick Dildos But Cum Before They Can Take It All The Way Down to the Base! Watch Them Spread Like Flowers As A Heavy-Duty Vibrator Rocks Their Their Fragile Cunts. When They Set Our Machines Right On thei

  • censoredcreampiesquirtingSVDVDsadistic villagekannana dainanashirouto sanka varietySVDVD-867SVDVD8671svdvd00867
    • 2021-03-12
    218 min

    [SABA-682]New Creampie Raw Footage, S********ls In Uniform Making Money On The Side vol. 005

  • censoredcreampieuniformSABAskyu shirototodoSABA-682SABA682h-244saba00682
    • 2021-01-17
    127 min

    [MRSS-104]I Looked Through My Wife's Phone And Found A Whole Collection Of POV Sex Tapes From The Time She Was A S*****t Made With Her Homeroom Teacher Yui Hatano

  • yui hatano censoredcreampiesingle workMRSSmisesu no sugao emmanuelleichiro yumisakimisses amateur faceMRSS-104MRSS104mrss00104
    • 2021-01-15
    237 min

    [SIM-105]"Hey Teacher, Let's Hurry Up And Fuck" This Private Tutor Is An Excessively Devilish Mofo Who Is Luring His Sch**lgirl Pupil To Temptation, And When They Fuck, He Doesn't Even Bother To Put On A Rubber, And Goes For A Totally

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-105SIM105118sim00105
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2020-12-18
    60 min

    [ETQR-170][Daydream POV] Close-up Sex With Rika, A Gorgeous Office Lady - Rika Aimi

  • rumi tadami censoredcreampieuniformETQRerotic timeETQR-170ETQR170h-1186etqr00170
    • 2020-12-18
    53 min

    [ETQR-171][Daydream POV] Close-up Sex With Yukino, A Gorgeous Office Lady - Yukino Nagasawa

  • yukino nagasawa censoredcreampieuniformETQRerotic timeETQR-171ETQR171h-1186etqr00171
    • 2020-12-11
    117 min

    [SABA-663]# New Girls In Uniform - Secret Deals For Cash 05 Asuka

  • censoredcreampiebig titsSABAskyu shirototodoSABA-663SABA663h-244saba00663
    • 2020-12-11
    198 min

    [SABA-665]New Creampie Raw Footage, S********ls In Uniform Making Money On The Side vol. 004

  • censoredcreampieuniformSABAskyu shirototodoSABA-665SABA665h-244saba00665
    • 2020-11-20
    239 min

    [SIM-098]I Came Too Much While Walking The Streets... This J* Had A Remote-Controlled Vibrator Installed In Her Pussy While She Took A Walk!

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-098SIM098118sim00098
    • 2020-11-20
    229 min

    [SIM-097]"I Love You Stepdaddy" He Got Remarried And Got A New Stepdaughter Who Loves Dirty Old Men. While Mom's Away, This Little Devil Is Luring Her Stepfather To Temptation For Adultery Sex All Throughout The House!

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-097SIM097118sim00097
    • 2020-11-05
    145 min

    [EKDV-649]Before I Knew It I Was Sexless... 40-Something Guys Broken In For A Second Time Aoi Kururugi x Miku Abeno x Yuri Shinomiya

  • aoi kururugi miku abe censoredcreampieuniformEKDVcrystal eizouookuma kintaroue kissEKDV-649EKDV64949ekdv00649
    • 2020-10-23
    239 min

    [SIM-095]"If Our Stepmom And Stepdad Found Out, We'll Be In Serious Trouble" I Had Plenty Of Creampie Sex With My Beloved Little Stepsister

  • censoredcreampieschoolgirlSIMprestigeno directoramateur pussiesSIM-095SIM095118sim00095
    • 2020-10-23
    240 min

    [MBM-226]No Parent Should Have To See This Video An Innocent Barely Legal Babe Gets Her Pussy Pumped Deep To Creampie Oblivion... As She Cums With Teary Eyes 4 Hours Her Innocent Pussy Is Destroyed With Shameful Sex 8 Babes Exposed In This Undergroun

  • censoredcreampieuniformMBMprestigegaro sasazukambmMBM-226MBM226118mbm00226
    • 2020-10-16
    244 min

    [SIM-094]A Naughty And Haughty J* Who Loves Money And Sex Is Selling Herself For Guaranteed Creampie Pay-For-Play Sex

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-094SIM094118sim00094
    • 2020-10-09
    120 min

    [SABA-651](A Country Girl) She's Born And Raised In The Backwoods Of Kyushu And Talks With A Country Accent And Has A Low Standard Deviation Score And Is A Stupid Bitch, But She's Super Beautiful... The Contrast Is Irresistible With This Stup

  • censoredcreampieuniformSABAskyu shirotomember aSABA-651SABA651h-244saba00651
    • 2020-10-09
    120 min

    [SABA-650]#New Uniform Daughter Shaved Back, Application 04 - Baseball Club Manager - Minami

  • censoredcreampieuniformSABAs kyuu shiroutotodoSABA-650SABA650h-244saba00650
    • 2020-10-09
    185 min

    [BAZX-253]Career Receptionist Dirty-Girl's Carnal Welcome vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-253BAZX253h-1496bazx00253
    • 2020-09-25
    225 min

    [SIM-092](Peeping While Cumming Home From School And At Home) (Juvenile Pranks) (Shameful Sex) I Slipped Into The Room Of A Natural Airhead Diamond-In-The-Rough J* And Then I Gave Her Some Aphrodisiacs And Bukkake Splattered Semen All Over Her Pussy

  • censoredcreampieSIMprestigeamateur pussiesSIM-092SIM092118sim00092
    • 2020-09-17
    240 min

    [DVDMS-577]The Magic Mirror Number Bus Special Edition! The Forbidden Shame MM Bus On The Other Side Of That One-Way Mirror Is Her Newly Remarried Mom! This S********l Stepdaughter And Her New Stepfather Are Placed In A Room And Taking On Their First

  • censoredcreampieuniformDVDMSdeep sthe magic mirrorDVDMS-577DVDMS577dvdms00577
    • 2020-09-11
    201 min

    [SABA-646]New Creampie Raw Footage, S********ls In Uniform Making Money On The Side vol. 003

  • censoredcreampieuniformSABAskyu shirototodoSABA-646SABA646h-244saba00646
    • 2020-08-28
    241 min

    [SIM-087]Horny Female S*****ts Bring Their Slutty Friends In A Chain Of Pickups [Linking Creampies] Fucked Raw In Sexy Costumes Edition

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-087SIM087118sim00087
    • 2020-08-27
    149 min

    [SVDVD-809]Shame! Outdoor Ass-Shattering Sex! A Super Amazing Big Bang Egg Vibrator Pussy Insertion Squirting Orgasmic Date! 17 Meet My Girlfriend Ichika Matsumoto

  • ichika matsumoto censoredcreampieamateurSVDVDsadistic villagetoranosukeSVDVD-809SVDVD8091svdvd00809
    • 2020-08-01
    241 min

    [SPO-011]Sailor Uniform And Rebellious, First Time Shots Raw Creampie 3

  • aoi kururugi yuri mochida censoredcreampieuniformSPOplumshirouto only plumSPO-011SPO011h-113spo00011
    • 2020-07-31
    240 min

    [EQ-524]Corrupt Amateur Nampa Seductions We Asked S********l Babes To Pussy Grind Us While Clothed And Then We Pumped Them Raw With Bad Intentions! 12 Girls 4 Hours

  • censoredcreampiebig titsEQbullittbarely legalEQ-524EQ524h-100eq00524
    • 2020-07-24
    244 min

    [SIM-084]If You Can Endure The AV Actor's Super Sex SK**ls You Get A Prize Of 300,000 Yen! Cute Naive S*********ls Bravely Challenge A Game Of Resisting Cumming From Supreme Sex SK**ls! If You Cum, Get Ready For Close Press Fuck And Continuous Ra

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-084SIM084118sim00084
    • 2020-07-19
    233 min

    [REXD-332]She Can't Make A Sound... A Female Prison Guard Getting Fucked By An Inmate! - "My Balls Are Full Of Cum And Ready To Burst!"

  • censoredcreampieuniformREXDredmanji groupREXD-332REXD332rexd00332
    • 2020-07-10
    214 min

    [SABA-633]All New Creampie Raw Footage Of A Tokyo Slut Gal S********l With Charisma To Spare Vol 002

  • censoredcreampieuniformSABAskyu shirototodoSABA-633SABA633h-244saba00633
    • 2020-07-10
    120 min

    [SABA-632]A Beautiful Y********l In Uniform Looks Into The Camera While She Gets Fucked By An Older Guy - 18yo, Utano-chan

  • censoredcreampieuniformSABAskyu shirototodoSABA-632SABA632h-244saba00632
    • 2020-06-26
    244 min

    [SIM-080]A Y********l In A School Swim Suit Gives A Lubed-Up Ass Job! Her Dripping Wet Pussy Is Ready To Get Fucked! Consecutive Creampie Sex With A Big Dick!

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-080SIM080118sim00080
    • 2020-06-19
    239 min

    [SIM-077]A Coed Who Smells Of Youth Gets A Mammary Exam With Tit Fondling. After Seriously Giving Her An Erotic Tit Massage Her Pussy Starts Throbbing When I Hold Her And She Lets Me Creampie Countless Times.

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-077SIM077118sim00077
    • 2020-06-12
    188 min

    [BAZX-237]New: Creampie Raw Footage Of A Beautiful Working Woman In Uniform vol. 001

  • censoredcreampieuniformBAZXkarmatodobazookaBAZX-237BAZX237h-1496bazx00237
    • 2020-05-29
    240 min

    [BAZX-236]Creampie Raw Footage Of A Big Tits Beautiful Y********l In Uniform SUPER MEMORIAL BEST HITS COLLECTION 4 Hours vol. 002

  • censoredcreampiebig titsBAZXbazookatodoBAZX-236BAZX236h-1496bazx00236
    • 2020-05-22
    231 min

    [SIM-076]This S********l Had Literally No Previous Sexual Experience, But Now She's Getting An Aphrodisiac-Laced Big Dick Relentless Irrumatio Good Time. After Getting A Furious Deep Throat Cock Stimulating Oral Ejaculation Experience... She Gets

  • censoredcreampieuniformSIMprestigeamateur pussiesSIM-076SIM076118sim00076
    • 2020-05-15
    120 min

    [SABA-620]A New Chapter This Beautiful Girl Wants To Get Fucked While Working A Secret Part-Time Job In Tokyo Remu-chan Has A Tall And Beautiful Body 003 Ever Since Her Sensuality Was Awakened, She's Been Having Babymaking Sex She's Available

  • censoredcreampieuniformSABAskyu shirotofc3 amateur fuck groupSABA-620SABA620h-244saba00620
    • 2020-05-15
    189 min

    [BAZX-234]Career Receptionist Dirty-Girl's Carnal Welcome vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-234BAZX234h-1496bazx00234
    • 2020-05-15
    229 min

    [BAZX-232]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-232BAZX232h-1496bazx00232
    • 2020-04-16
    119 min

    [GEKI-007]A Slender And Beautiful Nurse With A Hot Body Who Loves Creampie Sex Is A Diamond In The Rough Waiting To Get Fucked Mai Kamisaki

  • yuri fukada censoredcreampieschoolgirlGEKIan amazingly rare amateurog leakingGEKI-007GEKI007geki00007
    • 2020-04-10
    114 min

    [SABA-612]She Loves Old Men And Always Keeps Her Gaze On The Camera: Youthful Wild Sex With Beautiful Y********l in Uniform - Kanon, 141cm

  • censoredcreampieuniformSABAskyu shirototodoSABA-612SABA612h-244saba00612
    • 2020-04-04
    240 min

    [DVDMS-523]S*********ls In Uniform! - Rock, Paper, Scissors, Creampie! 2 - If They Win, They Get 1 Million Yen! If They Lose, They Get Fucked With A Big Dick! - Amateur S*********ls Get Their Innocent Pussies Fucked In Front Of Their Classmates! 4 Gi

  • censoredcreampieuniformDVDMSdeep syosukeDVDMS-523DVDMS523dvdms00523
    • 2020-03-27
    204 min

    [SKMJ-095]Calling All Innocent S*********ls! Please Help Out Your Local Cherry Boys! - Virgin Guys Get Excited By Y********ls' Bodies And Piston Fuck Them Non-Stop! Their Pink Pussies Get Filled With Cum!

  • censoredcreampieschoolgirlSKMJred face girlkikufukuSKMJ-095SKMJ095h-1324skmj00095
    • 2020-03-27
    243 min

    [SIM-068]"Am I A Masochist？" - S*********ls In Uniform Try S&M Vibrator Play For The First Time! - Tied Up And Unable To Move, They Each Take A Big Vibrator In Their Pussies! - The Stimulation Gets Them Wet And Makes Them Cum, And Finally

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-068SIM068118sim00068
    • 2020-03-20
    272 min

    [KFNE-038]Amateur POV Individual Filming

  • censoredcreampiebig titsKFNEprestigekurofune prestigeKFNE-038KFNE038118kfne00038
    • 2020-03-13
    119 min

    [SABA-604]A New Chapter Mio-chan Is A Beautiful Girl With Beautiful G-Cup Big Tits Who Is Working An Underground Part-Time Job In Tokyo 002 She Awakened Her Lust And Ever Since All She's Been Doing Is Making Babies We'll Rent Her Out To You T

  • censoredcreampiebig titsSABAskyu shirotofc3 amateur fuck groupSABA-604SABA604h-244saba00604
    • 2020-03-13
    203 min

    [SABA-608]New Creampie Raw Footage, S********ls In Uniform Making Money On The Side vol. 001

  • censoredcreampieuniformSABAskyu shirototodoSABA-608SABA608h-244saba00608
    • 2020-02-14
    120 min

    [SABA-598]A New Chapter Working An Underground Part-Time Job In Tokyo A 148cm Tall Beautiful Girl Who Wants To Get Fucked Kurumi-chan 001 Ever Since She Was Sexually Awakened, All She Wants To Do Is Have A Baby I'll Rent Her Out To You So You Can

  • censoredcreampieuniformSABAskyu shirotofc3 amateur fuck groupSABA-598SABA598h-244saba00598
    • 2020-02-07
    212 min

    [EQ-501]A Moe-Type Bashful S********l I Took Her Home For A Private Video Session I Creampie Fucked A Goddess I Discovered On Social Media LOL

  • kanon kanon censoredcreampiebig titsEQbullittno directorbarely legalEQ-501EQ501h-100eq00501
    • 2019-12-15
    123 min

    [TIKC-040][Peeping] I Raw Fucked This Girl In A Uniform, And Secretly Filmed It Too, And Now I'm Selling The Footage. TIKC- 040

  • censoredcreampieamateurTIKCtikitiki.comerTIKC-040TIKC040tikc00040
    • 2019-12-13
    122 min

    [SABA-581]*Caution: Super Erotic When Slutty* This Strong Chu-Hi D***k Has The Strongest Alcohol Content At 9 And It Works Like Super Crazy!! We Decided To Test It Out To See If It Would Work As An Aphrodisiac! She's Famous For Keeping Her Guard

  • censoredcreampieuniformSABAskyu shirotofc3 amateur fuck groupSABA-581SABA581h-244saba00581
    • 2019-12-12
    183 min

    [LMPI-018]A Complete Record Of Female S*****ts' Sex Wearing School Uniforms! Extreme Indecent Collapse Of Reason

  • censoredcreampiebig titsLMPImercurysperm dropLMPI-018LMPI018h-1133lmpi00018