beautiful girl cosplay javcensored creampie censored

FC2WAAASSNIMILKAVSAHZGDHMNMVSDDASDHNDNNPJRBDSTARSMIAAVEMADTTSQTEMEYDMIDVPPPDSSIS

2024-05-07
77 min

300NTK-862 [Natural G Milk Treasure BODY Yariman JD!!] [Gachi And Lewd Mind & Soul]!] [This Is Yariman!!This Is Yariman!!] Bakugo G Cup Dwatch Bodies JD!!Sexual Desire Is Also Gachiyariman Beautiful Girl!!Bie -sin G Cup G Cup Big Breasts Dwatch JD In

  • amateur censoredcreampiebig titsntkntk-862ntk862300ntk-862
    • 2024-05-02
    124 min

    337MILK-208 The Real Brother Is Eating With My Mako.Tenma Yui

  • tenmayui censoredcreampieuniformmilkmilk-208milk208337milk-208
    • 2024-04-21
    54 min

    362SCOH-144 [Creampie] Cosplay A Carefully Selected Beautiful Girl And Conceive My Child![E -Taso] Hikaru Tsuki

  • amateur censoredcreampieamateurscohscoh-144scoh144362scoh-144
    • 2024-04-20
    137 min

    FAZM-012 [Unlimited Launch 6p Large Orgy SEX] Jukyo 18 -year -old Beautiful Girl Layer VS Non -Mote Boy 5 [continuous D Kiss & Irama → Shaved Extra Thick Insertion] + 40 Years Old Maximum Loss Document Etc.

  • censoredcreampiecosplayFAZMall japan kameko cooperative delusional groupkeianikura momentumFAZM-012FAZM012fazm00012
    • 2024-04-13
    241 min

    SUJI-232 Striped Bread And Knee High Should Never Be Taken Off ... Twin Tails Low ● Creampie Sex 4 Hours

  • censoredcreampiecosplaySUJIrogue mousouzokuadultererSUJI-232SUJI232suji00232
    • 2024-04-13
    180 min

    NCYS-002 In Total Of 19 Shots 19 Shots 19 Shots Omabe Breaking Pillow Sales BEST SELECTION2 Idol Aspiring Beautiful Girl Cosplayers Four People Fall Into Semen Treatment Fools SEX In Extremely Thick Power Harassment SEX ... Screaming Without Acme

  • censoredcreampiecosplayNCYSall japan kameko cooperative delusional groupudagawaall japan kameko cooperative mousouzokuNCYS-002NCYS002ncys00002
    • 2024-04-12
    120 min

    MUKC-058 The Nature Of 148cm Beautiful Girl Cosplayers Is ... Premature Ejaculation Estrus Gachi Sperm A Pervert.Surrounded By Men, It Is A Climax Acme Firing, Rolling In Seconds, Meatpot Ring ● Inevitable.

  • censoredcreampiesquirtingMUKCinnocentsolid costMUKC-058MUKC058mukc00058
    • 2024-04-12
    140 min

    MIH-006 松本いちかと中出しSEXしたい人お気軽にDM下さい M男、早漏、絶倫男子と出会って即ハメ即パコ連続中出し！！ 松本いちか

  • ichika matsumoto censoredcreampiecosplayMIHbookthere is alsomatsumoto ichikaMIH-006MIH006mih00006
    • 2024-04-12
    141 min

    800MFO-061 [Idol Handshake Event] Purchase Benefits Are Vaginal Cum Shot To The Active Actor Idol!!The Manager Is Also Certified!This Is The Actual Situation Of A Peace Idol!<Delivery Limited Vol.01>

  • amateur censoredcreampieamateurmfomfo-061mfo061800mfo-061
    • 2024-03-16
    55 min

    pnme-190 Mio (20)

  • amateur censoredcreampieamateurpnmepnme-190pnme190pnme-190
    • 2024-04-03
    100 min

    483PAK-034 [I Love Baseball G Cup] [Fair And Beautiful Appearance] [Drinking SEX!] SEX With A Beautiful OL Who Lost The Last Train!Nan -cho Heaven # 024

  • maichan censoredcreampiesquirtingpakpak-034pak034483pak-034
    • 2024-03-30
    94 min

    326FCT-095 G Cup Beauty Who Likes Alcohol And SEX Beats From The Backspone Area!Raw Vaginal Cum Shot In A Fleshy Plump Muchimi Super Erotic Body!!

  • rina censoredcreampieuniformfctfct-095fct095326fct-095
    • 2024-03-29
    81 min

    326FCT-092 [Must -see For Woman On Top Posture] "If You Feel Good, You Can Speak Out (laughs)" Nipple Licking Spider -licking Spider -taught Cosplay With A Neat Girl Who Works In Corsen.

  • tomoka censoredcreampiesquirtingfctfct-092fct092326fct-092
    • 2024-03-29
    240 min

    MIZD-375 Emergency Piston Without Permission Across The Male Boobs!Observatory Of Naked Reverse Bunny Cowgirl BEST

  • tsujii honoka remi censoredcreampiecosplayMIZDmoody smoodyz bestMIZD-375MIZD375mizd00375
    • 2024-03-28
    240 min

    013ONEX-037 Dirty Chi ● Po -loves Jubojubo Mouth Service Made Doskebe Dirty Word Full Course

  • amateur censoredcreampieamateuronexonex-037onex037013onex-037
    • 2024-03-26
    90 min

    mfcs-108 Meipon (22)

  • amateur censoredcreampiesquirtingmfcsmfcs-108mfcs108mfcs-108
    • 2024-03-20
    220 min

    800MFOD-027 If The Virgin Of Me Is Reincarnated In A Different World, I Will Give You A Cheat Ability And Enjoy The Slow Life Of SEX -Reincarnation Chapter-

  • amateur censoredcreampieamateurmfodmfod-027mfod027800mfod-027
    • 2024-03-15
    130 min

    MUKC-056 Off -paco Orgy Photo Session That Connects Neat Underground Idols With Back Business.If You Can Recommend It, Our Slut Angel Who Can Unlimited Raw Vaginal Cum Shot.Matsuoka Misakura

  • matsuoka mio censoredcreampiecosplayMUKCinnocentsolid costMUKC-056MUKC056mukc00056
    • 2024-03-15
    170 min

    MUKC-047 Estrus Cosplay Beautiful Girls Who Are Immersed In Creampie Mating Full Clothes 8P Great Orgy

  • censoredcreampiecosplayMUKCinnocentsolid costMUKC-047MUKC047mukc00047
    • 2024-03-14
    93 min

    354KAMEF-073 Individual Specialization Cosmetic Photo Session Akari Nyan (21) BLACK KAMEKO FILE.73 Outside Store Connected Concafe Miss The First Raw SEX Experience For The First Time That You Can Not Tell To Anyone.

  • amateur censoredcreampieamateurkamefkamef-073kamef073354kamef-073
    • 2024-03-01
    140 min

    NOSKN-078 F Cup Amateur Concafe Miss Is A Creampie Creampie!An Amateur Cosplayer Sakura (20) Walnut Sakura (20) A 20 -year -old Tsundere Mine -based Beautiful Girl Is Crazy Due To A Middle -aged Father Of A Middle -aged Father

  • walnut sakura censoredcreampieamateurNOSKNnorthkinsNOSKN-078NOSKN0781noskn00078
    • 2024-02-27
    132 min

    201FNEO-085 Small Devil Beautiful Girl Ero Bitch Development Committee Love G -Cup Beautiful Beautiful Girl Who Loves To Pretend To Play Raw SEX.

  • shiosato censoredcreampieamateurfneofneo-085fneo085201fneo-085
    • 2024-02-24
    84 min

    CSPL-021 [4K] 4K Revolution Cheer Is Cute, But It Doesn"t Stop.Rabbit Wakui

  • wakui misato censoredcreampiebig titsCSPLcrystal picturecosdeluxe plusCSPL-021CSPL021cspl00021
    • 2024-02-16
    52 min

    393OTIM-355 Vulgar Flattery, Flattery, Impregnation Plea, Service Maid Who Is OK With Having Children RIANA

  • amateur censoredcreampieamateurotimotim-355otim355393otim-355
    • 2024-03-10
    62 min

    ddhp-050 Mi Ryo (20)

  • amateur censoredcreampieamateurddhpddhp-050ddhp050ddhp-050
    • 2024-03-07
    164 min

    MIST-429 Dangerous Day Hit!!Soapland That Can Make Children 51 Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiecosplayMISTmr michirusaitaMIST-429MIST4291mist00429
    • 2024-03-04
    133 min

    NAMH-006 Document 30ml 24 Hours Genuine Semen Vagina Back Firing Challenge Asuka Hyakuse (AV Actress) Kazuichi Himori (AV Actor)

  • momose asuka himori hajimori censoredcreampiecosplayNAMHnamanamaNAMH-006NAMH0061namh00006
    • 2024-03-03
    42 min

    801SKEJ-002 Mei (a Certain Regional Idol)

  • amateur censoredcreampiebig titsskejskej-002skej002801skej-002
    • 2024-02-29
    101 min

    354KAMEF-071 Individual Photo -specific Idol Photo Session Hiyorin (25) BLACK KAMEKO FILE.71 Absolute Innocent Nationwide National Top Idol Tofu Cosplay Photo Session Erections Erection.Gonzo Without Rubber

  • amateur censoredcreampieamateurkamefkamef-071kamef071354kamef-071
    • 2024-02-28
    81 min

    mfc-282 @Mion (21)

  • amateur censoredcreampieamateurmfcmfc-282mfc282mfc-282
    • 2024-02-26
    92 min

    752SSCJ-021 Ema

  • amateur censoredcreampiebig titssscjsscj-021sscj021752sscj-021
    • 2024-02-24
    120 min

    752SSCJ-019 Indefinite

  • amateur censoredcreampiebig titssscjsscj-019sscj019752sscj-019
    • 2024-02-21
    110 min

    483PAK-031 [Echiechi Esthetician] [Shaved Beautiful Body] [Squirting Of Raging] Squirting Ona Mad Pant Esthetic Essong!Appearance!Nan -cho Heaven # 022

  • riochan censoredcreampiesquirtingpakpak-031pak031483pak-031
    • 2024-02-20
    73 min

    763EMS-010 Tadaman Record That Is Convenient ○

  • amateur censoredcreampieamateuremsems-010ems010763ems-010
    • 2024-02-18
    41 min

    362SCOH-142 [Creampie] Make A Carefully Selected Beautiful Girl Cosplay And Impregnate My Child! [Abed] Nonoka Sato

  • ofsato censoredcreampieamateurscohscoh-142scoh142362scoh-142
    • 2024-02-18
    38 min

    362SCOH-140 [Creampie] Make A Carefully Selected Beautiful Girl Cosplay And Impregnate My Child! [Bri*t] Aoi Kururugi

  • aoikururugi censoredcreampieamateurscohscoh-140scoh140362scoh-140
    • 2024-02-17
    132 min

    NCYF-028 6P Big Orgy SEX Really Former Child Actor Talent Beautiful Girl Layer 18 Years Old Correcting The Personality Of A Cocky Female Brat [Crazy Bottomless Orgasm Torture] [Everyone Semen Pregnancy Experiment] [Infinite Loop Of Creampie On The Ve

  • censoredcreampiecosplayNCYFall japan kameko cooperative delusional groupudagawaall japan kameko cooperative mousouzokuNCYF-028NCYF028ncyf00028
    • 2024-02-16
    50 min

    393OTIM-357 Vulgar Flattery, Flattery, Impregnation Plea, Service Maid KANNA Who Is OK With Having Children

  • amateur censoredcreampieamateurotimotim-357otim357393otim-357
    • 2024-02-16
    42 min

    393OTIM-354 Vulgar Flattery, Flattery, Impregnation Plea, Child-making OK Service Maid AI

  • amateur censoredcreampieamateurotimotim-354otim354393otim-354
    • 2024-02-15
    84 min

    simm-873 Nana(18)

  • amateur censoredcreampieuniformsimmsimm-873simm873simm-873
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-13
    82 min

    752SSCJ-017 Konatsu

  • amateur censoredcreampiebig titssscjsscj-017sscj017752sscj-017
    • 2024-02-13
    92 min

    752SSCJ-015 Sara

  • amateur censoredcreampieamateursscjsscj-015sscj015752sscj-015
    • 2024-02-11
    45 min

    DDHP-048 Cheating Sex With A Chinese Maid Con Cafe Girl! Creampie Into A Female Brat With A Small And Beautiful Ass! [Sana (20)]

  • sana censoredcreampieamateurddhpddhp-048ddhp048ddhp-048
    • 2024-02-10
    240 min

    SABA-882 Cute As A Celebrity! Become Friends With A Beautiful Girl And Do A Follow-up Investigation! Assortment Of Cute SEX! A Huge Resemblance To The National Idol! Facial Deviation Value Exceeds 70! She Has A Great Personality And Loves Naughty Thi

  • censoredcreampieuniformSABAclass s amateurtodoSABA-882SABA882saba00882
    • 2024-02-09
    102 min

    800MFO-054 [Elf Clan Edition] A Story Where I, A Virgin, Was Reincarnated In Another World And Was Given The Ability To Cheat And Enjoyed A Slow Life Full Of Sex ~ Reincarnation Chapter ~

  • amateur censoredcreampieamateurmfomfo-054mfo054800mfo-054
    • 2024-02-07
    67 min

    COSX-052 M-chan, A Super Cute Layer With 48,000 Followers, Is Obsessed With Cospaco Photo Sessions With Old Men And Is Addicted To Punch Lines.

  • censoredcreampieamateurCOSXuncle pacohame taking uncleCOSX-052COSX052cosx00052
    • 2024-02-01
    84 min

    SIMM-871 [Yuzu-chan (18), A Slender J Who Shines In Sex♪♪A Pure Body With Only Her Boyfriend! Still Very Interested In H! Creampie To Healthy Slim-chan From The Soft Club♪】《J♪Erotic Record Of Girlfriend And Uncle Boyfriend》

  • yuzuchan censoredcreampieuniformsimmsimm-871simm871simm-871
    • 2024-01-28
    64 min

    DDHP-047 Creampie To A Chemo-eared Conference Cafe Girl With A High Face Run! Having Trouble With Money And Having Sex With A Fat Customer! [Hikari (19)]

  • hikari censoredcreampieamateurddhpddhp-047ddhp047ddhp-047
    • 2024-01-28
    89 min

    476MLA-162 H Cup Overwhelming Voluptuous BODY! ! It"s The Best Thing To Have A Big-breasted Plain Girl Who Is Serious At Work Play A Naughty Cosplay And Cum Inside Her Instinctively Lol

  • merutan censoredcreampiebig titsmlamla-162mla162476mla-162
    • 2024-01-26
    118 min

    ORECS-108 Pick Up A Female College Student With Outstanding Model-class Style! She Is Wearing A Bunny Girl Outfit, Exposing Her Sexy Legs And Cleavage, And Swaying Her Ass As She Boldly Serves You! "I Feel It More Than Usual...//" The JD Bunn

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-108ORECS108h-1732orecs00108
    • 2024-01-24
    69 min

    COSX-051 We Invited M-chan, A Super Cute Layer With 48,000 Followers, To Participate In An Erotic Spaco Photo Session.

  • censoredcreampieamateurCOSXuncle pacohame taking uncleCOSX-051COSX051cosx00051
    • 2024-01-21
    41 min

    362SCOH-137 [Creampie] Make A Carefully Selected Beautiful Girl Cosplay And Impregnate My Child! [Tomoe Mi] Tomoe Mi Kanna

  • amateur censoredcreampiebig titsscohscoh-137scoh137362scoh-137
    • 2024-01-21
    43 min

    362SCOH-138 [Creampie] Make A Carefully Selected Beautiful Girl Cosplay And Impregnate My Child! [16●Sakuya 2] Mio Ichijo

  • mioichijo censoredcreampieamateurscohscoh-138scoh138362scoh-138
    • 2024-01-20
    125 min

    AMBI-186 My Love For My Father Is So Strong That I Can"t Stop! ？ Knee High Girl"s Creampie Temptation Tennen Mitsuki

  • tennen mizuki tennen kanon censoredcreampiecosplayAMBIplanet plusgentlemanambibarentzAMBI-186AMBI186h-237ambi00186
    • 2024-01-19
    85 min

    KAMEF-065 Idol Photo Session Specializing In Individual Photography Mei-chan Machida Lens"s BLACK KAMEKO FILE.65 Hidden Blowjob At An Idol Festival Anicosu Sex Video Shoot Of A Real Lewd Idol An Energetic Girl"s Pussy Sucks Raw Cock And Cums

  • censoredcreampieamateurKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-065KAMEF065h-1350kamef00065
    • 2024-01-18
    67 min

    374IMGN-056 Ena-san

  • amateur censoredcreampiebig titsimgnimgn-056imgn056374imgn-056
    • 2024-01-18
    145 min

    DJN-009 Body Length: 146.2 Cm, Small Fry, Female Brat, Beautiful Girl Layer, Massive Squirting, Creampie Photo Session

  • censoredcosplayDJNmonstersDJN-009DJN009h-1762djn00009
    • 2024-01-14
    47 min

    DDHP-046 Two Creampies To A 93cm Big Breasts & 93cm Big Butt Con Cafe Girl! Infinite Piston On A Chinese Maid With A Sexy Body! [Kayaro (26)]

  • koyo censoredcreampiebig titsddhpddhp-046ddhp046ddhp-046