incest high vision jav upskirt censored




FC2SANWANZVENUDTTHNDHUNTBHDKANACRAWDCAWDHMNMARACESDSQTEMIAAAPODAMBIAVSAVENXGVH

2022-01-13
201 min

[SW-821]Lewd Education For Older Step-sister. She"s All Grown Up Now With A Curvy Body, And She Gets A Big Lesson From A Hard Dick!

  • censoredbig titssisterSWswitchyocchanswitch switchSW-821SW8211sw00821
    • 2021-11-25
    240 min

    [SW-812]Step-daughter Gives A Panty Shot With Her Curvy Ass That"s Just Too Much Temptation! "Tell Me More About The Naughty Things Step-mom Can"t Know About" Fakecest Dream Special - Step-daughter And Step-dad Compilation. That Body

  • censoredSWswitchyocchanswitch switchSW-812SW8121sw00812
    • 2021-10-21
    198 min

    [SW-807]Step-brother Has A Super Lovable Step-sister With No Bra And A Panty Shot For Lewd Temptation! It"s Going To Be Way Too Hard To Resist. Isn"t Her Body Just So Hot Looking These Days？! Ena Satsuki

  • ena satsuki censoredsistersingle workSWswitchraito fuji makotoswitch hibinoSW-807SW8071sw00807
    • 2021-10-07
    214 min

    [SW-803]Step-sisters" Skirts Are Too Short And Reveal Their Panties! They Show Off Their Lewd Acts And Masturbation To Their Step-brother, Making Him Lose It And Fuck Them Hard When Nobody"s Home!

  • censoredsisterSWswitchyocchanswitch hibinoSW-803SW8031sw00803
    • 2021-09-23
    124 min

    [GS-404]She"s Pretending To Be A****p, Unguarded, And Luring You In, Because She"s A Sweaty Little Devil, Your Little Stepsister!! One Hot Summer Day, While Our Parents Were Away, I Noticed My Little Stepsister"s Panties Were Dripping Wet

  • censoredsisterGSsosoru garconreddo bo ruGS-404GS4041gs00404
    • 2021-04-14
    159 min

    [ROYD-051]"Come Live With Me Again!" Our Parents Split When We Were K*ds, But Now My Stepsister Wants To Move In With Me Again, Eight Years Later! She's Grown Into An Adorable Young Woman Who Wants My Creampie Every Single Day Mao Watanab

  • mao watanabe censoredcreampieschoolgirlROYDroyalkoichi davidsonhhh groupROYD-051ROYD051royd00051
    • 2021-02-25
    122 min

    [IENF-125]My Kind And Gentle Big Stepsister And Little Stepsister Were Being So Nice To My Loser Ass, And They Made Me Promise That I Would Only "Rub My Cock Against Their Pussies" But Then They Felt So Nice That Their Cunts Were Dripping Wet

  • natsuki takeuchi nana maeno censoredbeautiful girlslutIENFienergykikurinienfIENF-125IENF1251ienf00125
    • 2021-01-21
    130 min

    [IENF-123]College Girl In Love With Her Stepfather Lets Him Catch Glances Of Her Panties When Mom Isn't Looking! Hoping For A Creampie, She Lets Him Fuck Her Raw Over And Over Again!!

  • toua kotone asahi drop censoredbeautiful girlslutIENFienergyienfIENF-123IENF1231ienf00123
    • 2020-11-26
    174 min

    [SW-739]"You Can't Get Hard For Your Own Stepdaughter, Can You？!" My Stepdaughters Keep Flashing Their Panties And Making Me And Their Stepbrothers' Dicks Throb - These Horny Brats Want To Gobble Cock Behind Their Mama's Back!

  • censoredSWswitchyocchanswitch switchSW-739SW7391sw00739
    • 2020-11-20
    229 min

    [SIM-097]"I Love You Stepdaddy" He Got Remarried And Got A New Stepdaughter Who Loves Dirty Old Men. While Mom's Away, This Little Devil Is Luring Her Stepfather To Temptation For Adultery Sex All Throughout The House!

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-097SIM097118sim00097
    • 2020-10-14
    42 min

    [NYH-039]Her Sexy Bootie Got Me Hard With All Those Flashes Of Her Panties, So She Let Me Stick It In Her - Me And Miku Miku Abeno

  • miku abe censoredsingle workNYHdirectorsmeow meow houseNYH-039NYH0391nyh00039
    • 2020-08-27
    205 min

    [SW-721]A Dream Cum True! I Want You To See This Video Record Of My Stepdaughter, Who's All Grown Up When I Saw Her Again For The First Time In Years

  • censoredSWswitchyocchanswitch switchSW-721SW7211sw00721
    • 2020-07-23
    240 min

    [SW-716]My Big Stepsister's Pretty Ass Panty Shot Action Is Like The Devil's Temptation! "I'll Teach You The Pleasures Of A Woman's Body, But We'll Have To Keep This A Secret From The Rest Of The Family!" A Big Stepsiste

  • censoredsisterSWswitchyocchanswitch switchSW-716SW7161sw00716
    • 2020-04-20
    121 min

    [VNDS-7083]Her Son In Law Tried To Act Like A Gentleman By Saying That He Didn't Like Older Woman, So The Bride's Mother Let Down Her Guard, And Came Over To Do Chores In An Ultra Short Miniskirt

  • censoredmature womanlingerieVNDSstar paradiseno directornext toilet r eVNDS-7083VNDS7083h-254vnds07083
    • 2019-12-13
    120 min

    [VRTM-468]I Peeked Under The Foot Warmer And I Saw My Stepdaughter's Panty Shot Flashing At Me! I Couldn't Resist, So When I Touched Her Still-Developing Pussy, She Started Getting Dripping Wet And Got Super Horny! Her Mother Is Sitting Right

  • scooping atomi shuri censoredcreampieuniformVRTMv r produceelza nagasakiVRTM-468VRTM468h-910vrtm00468
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-12-10
    261 min

    [EQ-490]When My Dad Got Remarried, I Suddenly Had A New Stepmom (Big Tits), A New Little Stepsister (Tiny Tits), And Now We're Keeping It In The Family With Creampie Sex!？ They're Always Prancing Around Scantily Clad, Looking Sexy, And Flashi

  • censoredcreampiebig titsEQbullittitazuraEQ-490EQ490h-100eq00490
    • 2019-12-07
    148 min

    [MIAA-197]Tempted By My Shy-Girl Step-Daughter I Can't Hold Back When She Provokes Me By Giving Me A Full View Of Her Unprotected Panties Mizuki Yayoi

  • mizuki yayoi censoredschoolgirlbeautiful girlMIAAmoodyzgoemoneveryone s porn starMIAA-197MIAA197miaa00197
    • 2019-11-30
    227 min

    [HUNTA-686]I'm In A Cramped Bathtub With My Excessively Big Tits Big Stepsister! I Was Getting Fucked For 3 Days And 2 Nights And Now I Was At My Absolute Limit! My Big Stepsister Came To Town To Stay With Me At My Small Apartment...

  • censoredcreampiesisterHUNTAhunterkawajirihhh groupHUNTA-686HUNTA686hunta00686
    • 2019-11-09
    118 min

    [MIAA-185]A Cherry Boy Little Stepbrother Who Took His Big Stepsister's Provocations Seriously And Didn't Realize That She Had Already Cum And Kept On Pumping Away At Her Pussy With Out-Of-Control Fury Kanon Kanade

  • kanon kanon censoredschoolgirlbeautiful girlMIAAmoodyzhatatai ryoeveryone s porn starMIAA-185MIAA185miaa00185
    • 2019-11-08
    111 min

    [VRTM-464]"You Want To See My Panty Shot Action, Don't You？" This Neat And Clean Girl Is Tempting Me By Begging For A Quickie! She's Hiding From Her Mom And Getting Her Father-In-Law's Cock For A Cum Crazy Orgasmic Good Time! And

  • scooping hikaru minazuki censoredcreampieVRTMv r producerokutanzo no seishiVRTM-464VRTM464h-910vrtm00464
    • 2019-09-20
    241 min

    [DOCP-172]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again! vol. 2

  • yui nagase natsuho imai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-172DOCP172118docp00172
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-12
    110 min

    [GS-282]This Little Stepsister Is Wearing A Short Uniform Skirt, And She's Always Flashing Panty Shot Action At Me! When I Warned Her, She Started Wearing Bloomers To Prevent Any More Panty Shot Action!？ But She Has No Problem Flashing Her Crotch

  • censoreduniformsisterGSsosoru x garconkinton kuriGS-282GS2821gs00282
    • 2019-07-11
    180 min

    [SW-640]When My Parents Got Remarried, I Got Some Little Devil Sisters-In-Law Who Were Luring Me To Miniskirt Panty Shot Temptation! I Was Always An Only Child, But Now, These Girls Were Living Under The Same Roof As Me, And Showing Off By Changing I

  • censoredsisterSWswitchyocchanswitch switchSW-640SW6401sw00640
    • 2019-06-06
    195 min

    [SW-636]You Like Looking Up Schoolgirl's Skirts, Don't You？ My Adorable Cousins From The Countryside Keep Trying To Seduce Me!

  • censoredSWswitchlight fujimaswitch switchSW-636SW6361sw00636
    • 2019-05-23
    215 min

    [SW-632]If You Wanna See A Schoolgirl's Panties, Give Me Money! My Cute Cousins Come To My Place Every Day And Pester Me For Money In Return For Playing With Me And Helping Me Around The House While Flashing Their Panties! They Said They'd Ne

  • censoredSWswitchlight fujimaswitch switchSW-632SW6321sw00632
    • 2019-05-17
    141 min

    [VRTM-429]She's Only Wearing Hot Pants, But She's Not Wearing Panties! Seeing Flashes Of His Older Stepsisters Cunt, This Cherry Boy Little Stepbrother Is Suddenly Rock Hard! Unable To Hold Back, He Jumps His Stepsister For A Quickie! His Fir

  • akemi miu ayumi reika censoredcreampiesisterVRTMv r produceyamanaka socksVRTM-429VRTM429h-910vrtm00429
    • 2019-05-17
    149 min

    [VRTM-427]"I'm Having My Father-In-Law's Baby!" The New Bride Wears Her Uniform While She Secretly Makes Him Cum! She Makes Him Pull Out Again And Again, For Repeated Huge Creampies! 2

  • arisaka miyuki akemi miu censoredcreampieVRTMv r produceeigo mochizukiVRTM-427VRTM427h-910vrtm00427
    • 2019-04-25
    160 min

    [SW-625]"Don't Tell Me That You Have Sexual Feelings For My Daughter, Do You？" My Wife's 3 Daughters Were Little Devils Who Were Luring Me To Temptation Wearing Ultra Short Miniskirt Outfits And Flashing Panty Shot Action At Me! From

  • censoredSWswitchyocchanswitch switchSW-625SW6251sw00625
    • 2019-03-21
    123 min

    [HBAD-471]A Sugar Daddy-Searching Girl With Brown Hair And Her Pale Pig Daddy And A Dark Baboon Father-In-Law She's Pretending To Give Away Her Pussy For Free, But Then She'll Hit You Up For Money, And Now It's Time To Teach This Greedy B

  • rina yamaoka censoredsingle workHBADhibinonamitaro umababeHBAD-471HBAD4711hbad00471
    • 2019-03-06
    150 min

    [GDHH-142]My Little Sister Is Wearing A Loose One-Piece Dress And I Can See Her Panties And Titties Peeking Out And It's Making Me Rock Hard! She's Always Prancing Around Without Her Bra On And I'm Secretly Getting A Hard On Watching Her!

  • censoredcreampieschoolgirlGDHHgolden timegorilla butahhh groupGDHH-142GDHH142gdhh00142
    • 2018-12-14
    149 min

    [VRTM-398]"Don't Look At Mom, Look At My Panty Shots..." My New Daughter Who Looks Neat And Clean Tempts Me And She Begs To Be Fucked Right There On The Spot! She Orgasms Wildly As She Fucks Her Stepfather Behind Her Mom's Back! She D

  • aoi kururugi blue censoredcreampieVRTMv r producesunao tanakaVRTM-398VRTM398h-910vrtm00398
    • 2018-11-22
    170 min

    [SW-594]"Daddy! If You Get An Erection From Seeing Your Daughter's Panties, You'll Be Punished!" I Was Getting A Hard On From Seeing My Wife's Daughter In Her Miniskirt, Flashing Panty Shot Action At Me My Daughter Was A Little De

  • censoredSWswitchyocchanswitch switchSW-594SW5941sw00594
    • 2018-11-08
    190 min

    [SW-592]Crazy Temptation Battle Between Cousins. Meeting My Cousins After A Long Time, I Find Out They've Grown And Have Hot Bodies. They Use Their Sexy Asses To Try To Seduce Me.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-592SW5921sw00592
    • 2018-10-25
    243 min

    [CVDX-328]Super-Wet Camel-Toe Mama's Pantyshots 30 Women 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-328CVDX328h-086cvdx00328
    • 2018-06-15
    336 min

    [HUNTA-461]"Hey Big Brother, Why Are You Touching My Flat Titties？？" My Schoolgirl Little Sister Is Seriously Cute, But Lately, I've Noticed A Bulge Growing In Her Chest, And I've Gotta Say, She's Just My Type!! She's Got A G

  • censoredsisterHUNTAhunterborubo nakanoHUNTA-461HUNTA461hunta00461
    • 2018-06-07
    180 min

    [SW-561]A Horny Big Sister This Big Tits Big Sister Will Press Her Big Ass And Titties Up On You And Say, "I'll Let You Cum Your White Semen All Over Me!" And Rub Herself All Over You, And Then She Assaulted My Underdeveloped But Naughty

  • censoredbig titssisterSWswitchyocchanSW-561SW5611sw00561
    • 2018-02-08
    145 min

    [IENE-860]No Matter How Many Times She Cums, This Orgasmic Cherry Boy Won't Stop His Hard Piston Thrusts! His Big Tits Big Sister-In-Law Tries To Escape, But He'll Keep Cumming After Her And Fucking Her Brains Out! "Please Stop! I've

  • censoredbig titssisterIENEienergyie nergyIENE-860IENE8601iene00860
    • 2017-12-07
    160 min

    [HBAD-395]This Schoolgirl Is Secretly Luring Her Cousin To Temptation With Her Bulging Panties, Behind Her Mother's Back Aoi Kururugi

  • aoi kururugi censoredschoolgirlsingle workHBADhibinoraito fuji makotoHBAD-395HBAD3951hbad00395
    • 2017-06-23
    151 min

    [SCPX-210]My Little Sister Got Her Panties Dripping Wet After Watching Some Incest AV!! I'm A Cherry Boy And I Was Hiding Some Brother And Sister AV Videos, But My Little Sister Found Them, And When I Peeked Under Her Skirt, I Found Out Her Panti

  • censoredcreampiesisterSCPXscoopone topmousouzokuSCPX-210SCPX210h-565scpx00210
    • 2017-04-20
    208 min

    [SW-479]You Like My Ass, Don't You？ This Schoolgirl Little Sister Loves Her Big Brothers, So She's Always Prancing Around Wearing Nothing But Bloomers, Or White Panties, Or Mini Tights, Or Swimsuits, Or Thongs, So She Can Show Off Her Pretty

  • shiina sky censoredsistersingle workSWswitchlight fujimaswitch switchSW-479SW4791sw00479
    • 2017-04-03
    237 min

    [GDHH-049]Forbidden Incest Threesome! Not Since My Student Days？ We Went On A Family Vacation To A Hot Springs Resort And Now I'm Sharing A Room With My Two Little Sisters!! My Sisters Have Really Bad Sleeping Habits So Their Robes Are Coming Und

  • censoredsisterGDHHgolden timebenzo sanhhh groupGDHH-049GDHH049gdhh00049
    • 2017-03-02
    188 min

    [SW-469]My Big Sister Lives In A Shared House With A Male Prohibition Rule, But I Got Inside Because I'm Her Little Brother These Female Residents Have Been Starved For Manly Cock, So They Welcomed Me With Panty Shot Temptation! When I Decided To

  • censoredSWswitchSW-469SW4691sw00469
    • 2017-02-05
    228 min

    [GDHH-042]Once She Falls Asleep, She's Not Getting Up Until The Break Of Dawn! My Big Tits Big Sister! She Won't Wake Up Even When I Grope Her Big Titties! She Won't Bat An Eye Even When I Lick Her Nipples! When I Take Things A Step Furth

  • censoredbig titssisterGDHHgolden timekiteretsuGDHH-042GDHH042gdhh00042
    • 2017-02-05
    214 min

    [HUNTA-255]A Horny Cherry Boy Loser In Creampie Fucking! I Quit My Job After 3 Days And Now I'm A Cherry Boy Loser Living At Home My Big Brother Has A Good Job And Married To A Pretty Lady And Also Lives At Home Too I've Never Lived With Anot

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-255HUNTA255hunta00255
    • 2017-02-02
    210 min

    [SW-464]Don't Look At Her Panties! When His Little Sister Was Hanging With Her Friends, She Caught Her Big Brother Peeking At Their Panties "I Hate You!" But Then, She Said, "You Only Get To Look At My Panties"

  • censoredschoolgirlsisterSWswitchraito fuji makotoSW-464SW4641sw00464
    • 2017-01-19
    201 min

    [SW-460]When My Dad Got Remarried, He Ended Up With 3 Daughters! I Was Always A Loser With The Ladies, But Now I'm Living The Dream With A Big Titty Mama And Some Hot Big Sisters! I Got My First Taste Of Panty Shot And Titty Shot Action, So Now M

  • censoredbig titssisterSWswitchyocchanSW-460SW4601sw00460
    • 2016-12-08
    179 min

    [SW-451]So You Got Excited Over Our Naked Bodies？ Oh How Cute!! While My Parents Were Away On Vacation, My Aunties Came Over To Keep The House Clean And An Eye On Me, But It Was Clear That They Were After My Rock Hard Cock!

  • censoredbig titsmature womanSWswitchtocchiSW-451SW4511sw00451
    • 2016-12-08
    205 min

    [SW-450]I Was A Total Loser With The Ladies So My Big Brother's Wife Started To Secretly Lure Me To Temptation And Now My Unpopped Cherry Is On The Verge Of Detonation Are You Still Going To Let Me Fuck You While My Big Brother Is Nearby？

  • censoredSWswitchyocchanSW-450SW4501sw00450
    • 2016-08-12
    131 min

    [RTP-077]On A Fiercely Hot day, The Air-Conditioner Broke and Turned Our House Into A Sauna! I Was Looking At The Girl In Uniform Who Couldn't Stand The Heat And Was Looking Comfortable As She Aired Her Panties Under Her Stuffy Skirt With An Elec

  • censoredschoolgirlsisterRTPprestigeupdatingRTP-077RTP077118rtp00077
    • 2016-06-23
    181 min

    [SW-416]Incest Dream! A Little Brother's Dick Gets Hard At The Sight Of His Big Sisters' Panties Beneath Their Miniskirts. No Matter How Many Times He Gets Off He's Ready For Another Round And His Sisters Can't Get Enough!

  • censoredsisterSWswitchyocchanSW-416SW4161sw00416
    • 2016-05-26
    114 min

    [SDDE-442]An Image Training Video For Those Time You Might Want To Commit Incest Imagine Meeting Your Niece After Several Years, To Find That She's Grown Into A Fine Young Woman, And Now You Can't Resist Peeking At Her Hot, Unguarded Body, An

  • censoredSDDEsod createkashiwakura hiroshiSDDE-442SDDE4421sdde00442
    • 2015-12-10
    215 min

    [DVDES-912]General Couple Monitoring AV Amateur University Students Must Seduce Their Brother's Through Daring Panty Shots! Although It's Embarrassing, These Guys Get Hard From The View! With The Deadline At Midnight, These Guys Are Unknowing

  • censoredamateurDVDESdeepsjohann yuanDVDES-912DVDES9121dvdes00912
    • 2015-09-24
    180 min

    [SW-356]An Incest Dream! I Thought I Could No Longer Feel Lust, But Seeing My Growing Daughters Innocently Flashing Panty Shots At Me, Daddy's Dick Became Young And Hard Again! My Daughters, Full Of Young Sexual Energy, Couldn't Resist Any Lo

  • censoredSWswitchyocchanswitch switchSW-356SW3561sw00356
    • 2015-08-06
    130 min

    [SW-347]Dream Incest! "Don't Tell Your Father, Okay？" My Mom's Still Sexy And I'm Getting My First Wood. She Squeezed My Hard Dick Somewhere My Dad Couldn't See Us.

  • censoredmomSWswitchyocchanswitch switchSW-347SW3471sw00347
    • 2014-12-20
    120 min

    [WANZ-277]Curvy Panty Shot Temptation Riko Honda

  • honda censoredbig titssingle workWANZwanz factorywanzWANZ-277WANZ277wanz00277
    • 2014-12-06
    140 min

    [IENE-497]I Caught a Glimpse of My Big Sister's Wet Panties When She Was Sleeping Under the Table and I Couldn't Help Stroking Her Ass...She Got Turned On and Started Sucking My Dick!

  • censoredsisterIENEienergykuniokaie nergyIENE-497IENE4971iene00497
    • 2014-08-09
    120 min

    [MIDE-141]Elder Sister's Tempting Panty Shots! Yui Nishikawa

  • yui nishikawa censoredbeautiful girlslutMIDEmoodyzmoodyz divaMIDE-141MIDE141mide00141
    • 2014-07-24
    132 min

    [SW-271]Incest Dream! "You've Looked At Big Sis's Panties Too Much (Heart)" I Get Rock Hard Looking At My Grown-Up Big Sisters, But It Was She Who Came Onto Me

  • censoredSWswitchyocchanswitch switchSW-271SW2711sw00271