jav creampie schoolgirl high vision javcensored




FC2AVSAAMBIMIAAATIDADNSSISMIDVNATRFSDSSSPRDSTARSMEYDDASDMILKHNDSANVENUGMEMKSBJLULU

2019-04-12
123 min

[FONE-055]3 Fresh Graduates Make Their Soaring Debuts!

  • censoredcreampieschoolgirlFONEfirst stardiscoveryFONE-055FONE055h-491fone00055
    • 2019-04-12
    160 min

    [MDBK-015]Secret Impregnation Date With A Cute, Young, Rental Girlfriend

  • arisaka miyuki abe mikako censoredcreampiesquirtingMDBKmedia stationk tarobazookaMDBK-015MDBK01561mdbk00015
    • 2019-04-12
    142 min

    [VRTM-423]"I Just Want To Grope That Ass, Just Once!" Her Daddy Was Feeling Horny For His Daughter's Big Ass Every Time He Saw It Wrapped In Black Pantyhose And Her School Uniform, So One Day He Slipped Her Some Date Rape Drugs, And Made

  • kuraki bookmark hikaru minazuki censoredcreampieschoolgirlVRTMv r produceyamanaka socksVRTM-423VRTM423h-910vrtm00423
    • 2019-04-12
    150 min

    [MDS-889]When I Tried To Ruin Her Promising Future By Giving Her A Creampie She Started To Fight Back Frantically. She Looked So Endearing... Rape Destroys Her Wonderful Life In A Girls' Dormitory

  • arisaka miyuki hikaru minazuki censoredcreampiesquirtingMDSmedia stationjohnny shibuyauchu kikakuMDS-889MDS88961mds00889
    • 2019-04-12
    149 min

    [SUPA-447]Lecherous Old Man Fucks A School Girl Raw And Films It In Return For Money

  • censoredcreampieschoolgirlSUPAskyu shirototetSUPA-447SUPA447h-244supa00447
    • 2019-04-10
    197 min

    [EQ-447]I Got Remarried To A Woman With A Schoolgirl Daughter Who Was Easy Prey For My Out-Of-Control Creampie Raw Footage Rampage! 3

  • yuri fukada shino asahina censoredcreampiebig titsEQbullittamateur drama lovers clubitazuraEQ-447EQ447h-100eq00447
    • 2019-04-07
    119 min

    [MIAA-054]I Have A Girlfriend For The First Time In My Life So I Practiced Sex And Creampies On My hildhood Friend. Akari Mitani

  • mitani akari censoredcreampieschoolgirlMIAAmoodyzeveryone s porn starMIAA-054MIAA054miaa00054
    • 2019-04-04
    172 min

    [GDHH-145]This Prim And Proper Sch**lgirl Who Wears Glasses And Knee-High Socks Is, To Our Surprise, Wearing A Thong! Knee-High Socks x Thong Panties Is Getting Us Excited To The Max! She's So Sexy, Of Course We're Getting A Full Erection!! I

  • censoredcreampieschoolgirlGDHHgolden timekorosukehhh groupGDHH-145GDHH145gdhh00145
    • 2019-04-04
    330 min

    [HUNTA-575]"No! Your Dick Is Inside My Pussy!! Please Stop!!" I Was Pussy Grinding With My Excessively Cute, Secretly Horny Childhood Friend, When My Dick Just Slipped Inside! It Felt So Good That I Kept It In There For Some Creampie Raw Foot

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-575HUNTA575hunta00575
    • 2019-04-04
    209 min

    [OYC-245]You Have 1 Minute To Think About It. The Ultimate 2 Choices! 1. You Can Stay Awake While I Fuck You 2. You Can Take A Sleeping Pill And By The Time You Wake Up, It Will All Be Over The Time Has Cum For Me To Get Revenge On This Girl That Had

  • censoredcreampieschoolgirlOYCoyashoku.companysleggerhhh groupOYC-245OYC245oyc00245
    • 2019-04-04
    457 min

    [HUNTA-578]A Childhood Friend Variety Project A 3-Video Special (Practice Sex With My Slutty Childhood Friend & My Childhood Friend Is Dating This Shitty Asshole That I Know! And This Shitty Asshole Is Showing Off How Sexy My Childhood Friend Look

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-578HUNTA578hunta00578
    • 2019-04-01
    233 min

    [AMBS-053]All Out! Shuri Atomi

  • atomi shuri censoredcreampieschoolgirlAMBSplanet plusanbibaresotsuAMBS-053AMBS053h-237ambs00053
    • 2019-03-31
    244 min

    [KTKY-036]"We Live In The Country, And There's Nothing To Do Out Here But Fuck!" Nationwide Barely Legal Girls Pictorial 4 Hours

  • censoredcreampieschoolgirlKTKYkitixx mousouzokuKTKY-036KTKY036ktky00036
    • 2019-03-29
    243 min

    [SIM-031]I Got Super Excited For A Sch**lgirl In Knee-High Socks And The Total Domain Of Her Hot Thighs...

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-031SIM031118sim00031
    • 2019-03-27
    215 min

    [FSKI-002]"I Can't Say No..." They Thought They Were Safe With A Female Masseuse At A Massage Parlor, But She's Suddenly Switched To A Male Masseur？! Beautiful Young Girls In Uniform Are Sweet-Talked Into Letting The Man Give Them An

  • censoredcreampiesquirtingFSKIfirst starultimate planFSKI-002FSKI002h-491fski00002
    • 2019-03-26
    115 min

    [KTRA-110]A Perverted, Beautiful Young Sub In Uniform. Trained In A Dirty Room. An Wakamoto

  • ann wakamoto censoredcreampieschoolgirlKTRAk tribeKTRA-110KTRA110h-094ktra00110
    • 2019-03-26
    125 min

    [KTRA-109]A Beautiful Real Masochist. Thick Creampies. Yui Tomita

  • yu tomita censoredcreampieschoolgirlKTRAk tribeKTRA-109KTRA109h-094ktra00109
    • 2019-03-22
    241 min

    [XRW-659]Thick Big Tits Girl Carnal Training 4 Hours

  • serizawa ruru itsuki maino censoredcreampiebig titsXRWreal worksreal real worksXRW-659XRW659172xrw00659
    • 2019-03-22
    241 min

    [SIM-029]A JK Braless Stroll!! When This Remote Vibrator Gets Turned Onn, Her Nipples Are Rock Hard And Erect! Will She Seriously And Bashfully Cum In Public!？ 2

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-029SIM029118sim00029
    • 2019-03-22
    200 min

    [BAZX-178]Sexual Acts With Sch**lgirls In Scarves Who Want To Get Raped vol. 001

  • censoredcreampieschoolgirlBAZXmedia stationtodobazookaBAZX-178BAZX17861bazx00178
    • 2019-03-22
    252 min

    [SKMJ-036]Picking Up Girls In Order Of Cuteness In Their Graduation Album

  • censoredcreampieschoolgirlSKMJred face girlyuseiSKMJ-036SKMJ036h-1324skmj00036
    • 2019-03-22
    227 min

    [MDTM-500]Girls In Uniform Are Deceived And Fucked By Older Men. 4 Hours

  • censoredcreampieschoolgirlMDTMmedia stationuchu kikakuMDTM-500MDTM50061mdtm00500
    • 2019-03-21
    224 min

    [PIYO-024]"I Don't Mind If I'm Not The One You Love Most, I Just Want You To Always Love Me..." The Days Of Love I Spent Driven Crazy By Adultery, With A Student Who Wanted Me To Give Her A Creampie And Get Her Pregnant <Chapter 2&g

  • censoredcreampiebig titsPIYOhyokopiero dabicchiPIYO-024PIYO0241piyo00024
    • 2019-03-21
    242 min

    [SDAM-012]"Give Me Cum In My Pussy" 6 Ovulation Creampies For A Girl Who Asks To Be Creampied An Hour After Her Graduation

  • censoredcreampieschoolgirlSDAMsod createanzoSDAM-012SDAM0121sdam00012
    • 2019-03-17
    119 min

    [MKON-005]Cute Librarian Gets Taken From Me By The Meathead PE Teacher. She Is Also Violated And Filled With Multiple Loads From Male Students And Transforms Into A Masochistic Sex Toy. Miyuki Arisaka

  • arisaka miyuki censoredcreampieschoolgirlMKONkaguyahimept mousouzokunortonmikonMKON-005MKON005mkon00005
    • 2019-03-15
    125 min

    [ZEX-369]Confinement All I Did Was Drop My Phone... A Video Record Of Several Days Spent In Breaking In Training With A Stalker Dirty Old Man

  • abe mikako censoredcreampieschoolgirlZEXpeters maxhideki hormonZEX-369ZEX369h-720zex00369
    • 2019-03-15
    208 min

    [DOCP-136]My Little Sister Looks Innocent But She's Really Dirty!？ I Lost Control Of Myself When I Saw Her Looking Sexy After a Bath So I Pushed Her Down And Started Touching Her Sexy Body...

  • miho yoshiike shuri atomi censoredcreampieschoolgirlDOCPprestigedoc premiumDOCP-136DOCP136118docp00136
    • 2019-03-15
    124 min

    [KTRA-106]The Beautiful And Obedient Honor Student

  • censoredcreampieschoolgirlKTRAk tribeKTRA-106KTRA106h-094ktra00106
    • 2019-03-11
    124 min

    [INCT-034]Men's Sex Toy Black Haired Beautiful Girl Becomes A Sex Toy 18 Year Old Ai Minano

  • ai minano censoredcreampieschoolgirlINCTinnocent herobirdman teppeiINCT-034INCT034inct00034
    • 2019-03-10
    120 min

    [MIAA-034]This Dirty Old Man And A Beautiful Young Girl In Uniform Are Having Deep And Rich Kissing Consecutive Creampie Sex Aoi Kururugi

  • aoi kururugi censoredcreampieschoolgirlMIAAmoodyzgoemoneveryone s porn starMIAA-034MIAA034miaa00034
    • 2019-03-08
    126 min

    [YMDD-150]My Girlfriend Is A Beautiful, Young, Slutty Sub. Miyuki Arisaka

  • arisaka miyuki censoredcreampiesquirtingYMDDmomotaro eizoasakusa ga jirowakamomoYMDD-150YMDD150ymdd00150
    • 2019-03-08
    149 min

    [SKMJ-031]She Was A Schoolgirl Till Just 3 Minutes Ago!!!! Making Her Porn Debut Straight After Graduation. Miraculous, Natural H-Cup Tits. 18 Years Old, Mina Hanasaki

  • hanasaki censoredcreampiebig titsSKMJred face girlone topSKMJ-031SKMJ031h-1324skmj00031
    • 2019-03-08
    130 min

    [REAL-693]Schoolgirl Pregnancy Fetish Rape Creampies 20 Cumshots Yuri Shinomiya

  • yuri shinomiya censoredcreampiesquirtingREALreal worksnavereal real worksREAL-693REAL693172real00693
    • 2019-03-08
    148 min

    [SCOP-606]Interviewing A Schoolgirl Who Shoplifted Without Much Thought In A Shop Somewhere In Tokyo! We Give An Aphrodisiac To The Brash Girl Who Won't Fess Up! As Soon As She Drinks It, She Orgasms Repeatedly. Sex In The Office!

  • censoredcreampiesquirtingSCOPscoopk taromousouzokuSCOP-606SCOP606h-565scop00606
    • 2019-03-08
    165 min

    [MDBK-006][Complete POV Porn] Popular In A Panty-less High School. My Harem School Life With Panty-Less Schoolgirls

  • abe mikako hoshizaki censoredcreampieschoolgirlMDBKmedia stationkuwattibazookaMDBK-006MDBK00661mdbk00006
    • 2019-03-08
    152 min

    [SUPA-440]We Went Picking Up Girls At This Hot Spot Rumored To Be Filled With People Who Want To Fuck And We Found This J* Bitch Ready For Some Creampie Raw Footage

  • censoredcreampiesquirtingSUPAskyu shirotomisoni komiSUPA-440SUPA440h-244supa00440
    • 2019-03-07
    128 min

    [RCTD-206]Dirty Talk Gal Academy Shibuya Binaural School Talk

  • shimotsuki runa yuzuki aisha censoredcreampieschoolgirlRCTDrocketscarecrowRCTD-206RCTD2061rctd00206
    • 2019-03-06
    150 min

    [GDHH-142]My Little Sister Is Wearing A Loose One-Piece Dress And I Can See Her Panties And Titties Peeking Out And It's Making Me Rock Hard! She's Always Prancing Around Without Her Bra On And I'm Secretly Getting A Hard On Watching Her!

  • censoredcreampieschoolgirlGDHHgolden timegorilla butahhh groupGDHH-142GDHH142gdhh00142
    • 2019-03-06
    236 min

    [TSP-416]Leaked By A TV Producer! Some Of The Victims Were Virgins？! He Took Home Schoolgirls From His Show! Toro Toro Kiss With An Aphrodisiac Lozenge Makes The Girls Go Weak! He Then Secretly Films The Creampie Sex

  • censoredcreampieschoolgirlTSPtokyo specialTSP-416TSP416tsp00416
    • 2019-03-06
    239 min

    [HUNTA-561]"Hey, Big Brother. You're The Only One Who Praises My Titties." "You're The Only One Who Says Nice Things About My Cock..." A Colossal Tits Little Sister-In-Law Who Is Self-Conscious About Her Excessively Huge Tits

  • censoredcreampiebig titsHUNTAhuntermorikihhh groupHUNTA-561HUNTA561hunta00561
    • 2019-03-01
    237 min

    [BUR-523]Lo**** Highlights 4 Hours 6

  • censoredcreampieschoolgirlBURglay zburst graceBUR-523BUR52312bur00523
    • 2019-03-01
    125 min

    [AMBI-096]The Beautiful Girl Who Skips School Is The Horny, Slutty Captain Of The Volleyball Team. An Mita

  • miharu kawada anri mita censoredcreampieschoolgirlAMBIplanet plusbirdman teppeianbibaresotsuAMBI-096AMBI096h-237ambi00096
    • 2019-02-28
    120 min

    [WANZ-841]"Hey! You Just Came Inside Me, Didn't You？" Keep Fucking Her Without Pulling Out So She Won't Notice You Came Prematurely And Give Her A Creampie!! Emi Sakuma

  • emi sakuma censoredcreampiebig titsWANZwanz factorywanzWANZ-841WANZ841wanz00841
    • 2019-02-28
    116 min

    [WANZ-839]Bukkake Molestation Bus. Targeted By A Gang Of Insatiable Men, She's Assaulted, Creampied And Gang Raped. Sora Shiina

  • shiina sky censoredcreampieschoolgirlWANZwanz factorywanzWANZ-839WANZ839wanz00839
    • 2019-02-27
    224 min

    [MEKI-013]We Went Picking Up Girls And Found This Cute Schoolgirl, Full Of Innocence! This Young Girl Had Never Cum With Her Boyfriend's Cock, So Now We're Defiling Her Body And Hitting Her With Asshole-Baring Piston Pounding Dick Thrusts! Wh

  • censoredcreampieschoolgirlMEKImercurykikukawaultimate planMEKI-013MEKI013h-1133meki00013
    • 2019-02-24
    113 min

    [APNS-108]I Was Their Plaything... I Wanted To Put It All Behind Me... But My Heart Was Broken Again And My Body Tainted By Their Juices... Rin Sasahara

  • sakihara rin censoredcreampieschoolgirlAPNSaurora project annexyukihiro nasuaurora project anexAPNS-108APNS108apns00108
    • 2019-02-22
    140 min

    [MDS-886]The Most Beautiful, Neat And Clean Girl In Her School Gets Emotional Fulfillment From Sex And She Wants To Be Creampied. Fumika. Fumika Hatsuno

  • hatsuno fumika censoredcreampieschoolgirlMDSmedia stationgenius hizauchu kikakuMDS-886MDS88661mds00886
    • 2019-02-22
    240 min

    [OKAX-479]I Can Never Tell My Parents... The Truth Is, I'm Being Raped Every Day After School 2

  • censoredcreampieschoolgirlOKAXk m produceokazuOKAX-479OKAX47984okax00479
    • 2019-02-22
    239 min

    [BAZX-175]A Modern Cute Gal Schoolgirl vol. 006

  • censoredcreampieamateurBAZXmedia stationtodobazookaBAZX-175BAZX17561bazx00175
    • 2019-02-22
    133 min

    [MDTM-488]My Very Own Sch**lgirl Idol Who Will Let Me Creampie Fuck Her Anytime I Want Emi Sakuma

  • emi sakuma censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-488MDTM48861mdtm00488
    • 2019-02-21
    158 min

    [MIST-247]VIP Treatment From The JO Research Club 5 Minori Kotani

  • minori otani censoredcreampieschoolgirlMISTmr michirusaitaMIST-247MIST2471mist00247
    • 2019-02-17
    120 min

    [DDHH-001]Distribution Of Indecent Material. A Schoolgirl Is Turned On By Videos Received Through AirDrop. Hikaru Minazuki

  • hikaru minazuki censoredcreampieschoolgirlDDHHdogmahidekiDDHH-001DDHH001ddhh00001
    • 2019-02-17
    119 min

    [TIKP-030]A Serious And Plain Girl Who Looks Good In Her Uniform Gets Raped By Extremely Horny Middle-Aged Men. True Story. Rika Ayumi

  • ayumi reika censoredcreampieschoolgirlTIKPtikitiki.comerTIKP-030TIKP030tikp00030
    • 2019-02-16
    152 min

    [PPPD-742]Welcome To The After-School Titty Massage Parlor!! 5 Rejuvenating Creampie Courses With A Schoolgirl In Uniform. Ren

  • censoredcreampiebig titsPPPDoppaiPPPD-742PPPD742pppd00742
    • 2019-02-16
    240 min

    [HUNTA-553]"Hey Uncle, Can I Give You A Blowjob？" "What! I Want To Suck His Dick Too!" "Hey, No Fair! Me Too!" My 6 Nieces Are At My House In My Bathtub, Fighting Over My Cock! My 6 Nieces Had Come Home For The First Time In

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-553HUNTA553hunta00553
    • 2019-02-16
    162 min

    [AP-633]Super Sensitive! Premenstrual Schoolgirls. Nipple-Twisting Sexual Harassment During A Physical Exam. "Every Girl Gets A Creampie" Version

  • censoredcreampieschoolgirlAPapachekuniokahhh groupAP-633AP633ap00633
    • 2019-02-15
    120 min

    [ZEX-367]All-Girls School Time Freeze

  • censoredcreampieschoolgirlZEXpeters maxtime stopping maxZEX-367ZEX367h-720zex00367
    • 2019-02-12
    228 min

    [MEKI-012]"She Can't Possibly Say No..." She Came To This Massage Parlor To Elevate Her Womanhood, And Quickly Got Seduced By The Male Therapist Into Giving Her Body Over To Sexual Pleasures This Is What Happens When A Beautiful Young Gir

  • censoredcreampiesquirtingMEKImercuryultimate planMEKI-012MEKI012h-1133meki00012
    • 2019-02-10
    145 min

    [APKH-094]Attentive, Beautiful Young Girl In Uniform H. If I Like The Guy, I Can Lick Not Just His Dick, But His Asshole Too... Rika Ayumi

  • ayumi reika censoredcreampieschoolgirlAPKHaurora project annexaurora project anexAPKH-094APKH094apkh00094
    • 2019-02-09
    118 min

    [MIMK-066]My Little Brother's Dick Is Huge, Wanna Come See It？

  • mitani akari aika censoredcreampieschoolgirlMIMKmoodyzkitorune kawaguchimankitsuMIMK-066MIMK066mimk00066