jav javcensored high vision slut amateur




FC2AWDSSNIPREDLULUAUKGNGODSPRDHUNTBVEMAGVHDTTMEYDSSISFSDSSMIDVCHRVNATRCAWDJUFEMILK

2022-02-23
88 min

[IENF-189]Picking Up Girls Featuring Amateur S********ls. Girls That Are Super Curious About Sex Enjoy Nipple Play For The First Time! "Do Male Nipples Feel It Too？" Masochistic Guy Gets Hard In Agony Over This Sadistic Teasing! Getting His N

  • natural mizuki lara kudo censoredcreampieschoolgirlIENFienergyienfIENF-189IENF1891ienf00189
    • 2022-02-19
    121 min

    [ONIN-073]Gather Round To Fuck A BBW--This Fat, Lazy Slut Likes Her Sex Hot And Sweaty

  • censoredamateurONINtamanegi mousouzokudoryu barrymoretamanegiONIN-073ONIN073onin00073
    • 2022-02-19
    138 min

    [HALT-003]Seducing Two Job Seeking Sluts With Colossal Tits Lick Their Rock-Hard, Erect Nipples!! Round-Assed Hot MILFs Get Rocked For Real Hear Them Beg To Get Creampied

  • censoredcreampiebig titsHALThalentino daydream tribehalentinocomplete amateur match making partyHALT-003HALT003halt00003
    • 2022-02-12
    127 min

    [CHCH-016]Slutty Horny Bust Amateur Housewife"s Dream Comes True! Riko (26 Years Old)

  • censoredbig titsamateurCHCHmilk and moms emmanuellemilk and momsCHCH-016CHCH016chch00016
    • 2022-02-05
    192 min

    [KAGP-216]Thick And Rich Fellatio Service 2 - 10 Reiwa Amateur Girls Found On A Matching App

  • censoredamateurblowjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-216KAGP216kagp00216
    • 2022-02-03
    212 min

    [STSK-014]"I"ll Study Super Hard So Please, Please Teach Me How To Have Sex... That"s What You Like, Right Teacher？" Studious S********l Seduces Her Private Tutor... He Knows It"s Wrong, But He Just Can"t Resist Her Lustful Te

  • censoredcreampieschoolgirlSTSKamateur 39STSK-014STSK014h-1605stsk00014
    • 2022-01-15
    127 min

    [KTKC-131]A Girl With G-cup Tits And A Tall Hourglass Figure In A Maxi Dress. Crazy Video Featuring A College Girl Turning Into A Slut After Spending The Day At The Park Having A Few While Her Lewd Figure Stands Out.

  • censoredbig titsamateurKTKCkichikkusu mousou zokukyonyuuKTKC-131KTKC131ktkc00131
    • 2021-12-09
    89 min

    [IENF-182]Amateur Pick Up Tales Naive Girl Who"s Used To Being Submissive And Who"s Never Taken The Lead With A Man Before Tries Dominating A Masochistic Guy For The First Time Watch Her Blossom Into A Talented Dominatrix! She Plays With His

  • akari shinmura mai takeda censoredcreampiebig titsIENFie nergytaiga kosakaiieneIENF-182IENF1821ienf00182
    • 2021-12-04
    121 min

    [BAHP-096]AV Debut! Nursery Teacher Who Cannot Reveal Face. Can Appear With Mask! When She Undresses Has Well Proportioned Body And Loves Lewd Sex.

  • censoredbig titsamateurBAHPbaltanyosukehoppinBAHP-096BAHP096bahp00096
    • 2021-11-06
    120 min

    [BADA-023]Welcome, You Married Woman! Married Women Covered with Sluttiness vol. 2

  • censoredamateurslutBADAbarutanyuuseidiamondBADA-023BADA023bada00023
    • 2021-10-16
    165 min

    [KAGP-198]ご奉仕濃厚フェラチオ マッチングアプリで見つけた令和素人娘10人

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-198KAGP198kagp00198
    • 2021-10-15
    150 min

    [EBOD-858]Expert Level Slut Aya Izumi Has An Amateur Masochistic Guy All To Herself! Reverse Pick Up. Shes Takes This Masochist In To Get Full Cum Loads Out Of Him In This Special. Aya Izumi

  • aya izumi censoredbig titsslutEBODe bodytorendei yamaguchiEBOD-858EBOD858ebod00858
    • 2021-10-15
    148 min

    [BLK-531]Taking A Slutty Gal Till Morning! Ending Up At A Love Hotel After A Late Night Out In Kinshi-cho. She Works That Dick Over And Over All Night Long In The Hotel Room!

  • censoredcreampiebig titsBLKkira kirakira hosi kira black galBLK-531BLK531blk00531
    • 2021-10-07
    128 min

    [IENF-170]Amateur Pick Up Naive College Girl Has Her First Experience At A Brothel For Ladies 3

  • yuzu shirakawa hope light censoredcreampieslutIENFie nergytaiga kosakaiienfIENF-170IENF1701ienf00170
    • 2021-10-02
    122 min

    [KTKC-127]The Strongest Amateur Nympho Whom I Ever Encountered Was A Massage Parlor Girl Who Had Colossal Tits: Yayoi (H-Cup).

  • censoredbig titsamateurKTKCkichikkusu mousou zokukyonyuuKTKC-127KTKC127ktkc00127
    • 2021-08-24
    150 min

    [KUSE-026]Amateur Demands Her Favorite Dicks For A Blowjob Home Visit! Unexpected Creampie For First-time Sex？! Plenty Of Cum In This All Out Sex Fest On Camera. 7x Dicks, 12x Cum Shots, 11x Cum Swallowing! Minami Iroha

  • minami iroha censoredcreampieamateurKUSEsod createichinose kurumijoyuu no kuse ga sugoiKUSE-026KUSE0261kuse00026
    • 2021-08-14
    175 min

    [KAGP-193]Amateur Girl Is Actually Amazing At Blowjobs, 10 Modern Amateurs Met Online, 180 Minutes

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-193KAGP193kagp00193
    • 2021-08-10
    153 min

    [KMHRS-047]Slowly Developing Secret Slut"s Hidden Personality Until She Cums With Her Whole Body Wet, Noel Honda

  • honda noeru censoredsquirtingamateurKMHRSsod createkaorukimihoreKMHRS-047KMHRS0471kmhrs00047
    • 2021-07-02
    170 min

    [DVDMS-683]Ordinary Couple Hidden Camera Footage AV X Magic Mirror Bus Collaboration Project "While In Japan These Cabin Attendants Can't Get Over Wanting To Try Japanese Cock" Is The Rumor True!？ A Chinese Cabin Attendant With Beautiful

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-683DVDMS683dvdms00683
    • 2021-06-24
    140 min

    [HAWA-250]"Y********ls Just Want To Suck Dick!" Plump Slutty Housewife Kozue Happily And With Expert Use Of Her Tongue Slurps Dick Younger Than Her Husband's

  • censoredamateurblowjobHAWAkosumosu eizouhide monkcosmospictures soft on demandHAWA-250HAWA2501hawa00250
    • 2021-06-24
    175 min

    [NHDTB-546]This Slut Knows How To Make Guys Cum - Men Can't Resist Her Aphrodisiac Kisses And Skillful Handjob Technique

  • censoredamateurbeautiful girlNHDTBnatural highneapolitanNHDTB-546NHDTB5461nhdtb00546
    • 2021-06-04
    171 min

    [DVDMS-671]A Normal Boys And Girls Focus Group Adult Video x The Magic Mirror Number Bus Collaboration Variety Special Is It True That After A Flight, Cabin Attendants Want Cocks So Badly That They Can't Control Themselves!？ This Cabin Attendant

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-671DVDMS671dvdms00671
    • 2021-04-27
    120 min

    [PAIS-003](Forum Posting) I Tried Secretly Filming A Busty, Charismatic Brothel Babe, But When She Caught Me Dominated Me Beyond My Wildest Dreams *If Leaked To The Brothel, This Will Get Taken Down

  • censoredbig titsamateurPAISmercurycricketpie otsukai day clubPAIS-003PAIS003h-1133pais00003
    • 2021-04-14
    180 min

    [DVDMS-656]You Can't Escape This Cute Slut's Nipple Teasing - 10 Days Of Creampie Sex - Horny Smiling College Girl Won't Stop Until You're Satisfied (You Weren't Expecting It)

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-656DVDMS656dvdms00656
    • 2021-04-09
    144 min

    [DASD-847]The Face Of A Model, But The Kinks Of A Total Slut - A Single Mother's Mature Nipples Teased Until She Succumbs To Her Lust - Fun With A Nympho Divorcee. (*Of Course, She Gets Fucked Raw)

  • censoredcreampieamateurDASDdasDASD-847DASD847dasd00847
    • 2021-03-27
    146 min

    [NINE-046]Breast Milk Bukkake! "I Wanna Do Age Play With A Guy" New MILF Slut Gives In To Her Strange New Carnal Instincts! Frustrated Wife With Colossal Tits Makes Her Porn Debut. Hiroko (Age 34)

  • censoredbig titsamateurNINEmercurychateaubriand hutNINE-046NINE046h-1133nine00046
    • 2021-03-27
    134 min

    [NINE-047](Rare Goods Received: Young Cutie With J-Cup Tits) Office Slut With Colossal Tits Starts A Secret Date Club - Leaked Hidden Camera Footage.

  • censoredbig titsamateurNINEmercurychateaubriand hutNINE-047NINE047h-1133nine00047
    • 2021-03-23
    122 min

    [KMHRS-040]"I'll Be Your Very Own Personal Slut, Step Brother!" Devilish Y********l Meru Kusumi

  • kusumi censoredamateurslutKMHRSsod createtiger kosakaikimihoreKMHRS-040KMHRS0401kmhrs00040
    • 2021-03-18
    154 min

    [DVDMS-646]"You Get Hard When Somebody Touches Your Nipples... Are You A Perv？" The Married Woman Next Door Teases The Nipples Of A Guy Who Happens To Be A Total Sub - This MILF Slut Loves Every Minute Of Milking His Dick, Edging Out Every La

  • censoredbig titsamateurDVDMSdeep sswing nagaseDVDMS-646DVDMS646dvdms00646
    • 2021-03-13
    194 min

    [HJMO-456]This Husband And Wife Are Taking The Challenge! If The Husband Succumbs To Honoka Tsujii's Amazing Techniques And Cums Twice, His Wife Will Be Subjected To Raw Cuckold Creampie Sex!

  • tsujii honoka censoredcreampiebig titsHJMOhajime kikakuHJMO-456HJMO456hjmo00456
    • 2021-02-23
    235 min

    [SDJS-106]Nakayama-chan Is A New Employee At SOD And She Was Given Company Orders To Start Working At A Popular Sex Club So That We Could Find Out, What Would Happen？ A Pink Salon / A Delivery Health Call Girl Service / A Happening Bar / A Maso Sensu

  • kotoba nakayama censoredamateurslutSDJSsodgoemonSDJS-106SDJS1061sdjs00106
    • 2021-02-19
    125 min

    [KTKC-106]These Are The Famous Streetwalking Reverse Pick Up Colossal Tits Girls In A Town In The Northern Kanto Region, Who Have Recorded 3,000 Mounting, Grinding, Raw Cowgirl Fucks, And We've Captured 12 Fucks In One Day In The Creampie Documen

  • censoredcreampiebig titsKTKCkitixx mousouzokubig titsKTKC-106KTKC106ktkc00106
    • 2021-02-19
    223 min

    [SIM-109]My Super Young Stepmom Is A Total Slut - She's Down To Fuck Her Stepson Any Time He Wants

  • censoredcreampieSIMprestigeamateur pussiesSIM-109SIM109118sim00109
    • 2021-02-18
    165 min

    [DVDMS-634]She's Got A Cute Face And A Bushy Pussy! This Perverted College Girl Loves To Get Cunnilingus When She Gets Her Deep Forest Of Pussy Hairs Licked, It Awakens Her Perversions ... And Then She'll Beg For Creampie Sex, Over And Over A

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-634DVDMS634dvdms00634
    • 2021-02-12
    217 min

    [DSS-221]We Seduced An Amateur With A Beautiful Body!! No.221 Search For The Divine Body Method! A Street Filled With Fabulous Beauties

  • censoredbig titsamateurDSSmomotaro eizodukelady huntersDSS-221DSS221dss00221
    • 2021-02-12
    136 min

    [CHN-197]New: We Lend Out Amateur Girls. 95 (Pseudonym) Suzune Akimoto (Grocery Store Clerk) Age 20

  • akimoto suzune censoredanalslutCHNprestigemanhattan kimurataiCHN-197CHN197118chn00197
    • 2021-01-22
    53 min

    [WKD-038]Amateur File

  • censoredcreampieslutWKDwaap entertainmentk westwWKD-038WKD0382wkd00038
    • 2021-01-19
    141 min

    [SDTH-001]Cheerful Cum-Guzzling Sub Slut. She Loves Sex More Than Money - This Amateur Starred In Porn To Get Fucked. Upscale Real Estate Agent Working In Tokyo For Two Years - Cum Swallowing Yuki Mishima (Pseudonym - Age 23) Her One-Night, Two-Day P

  • censoredSDTHsod createietaroeromanceSDTH-001SDTH0011sdth00001
    • 2021-01-17
    133 min

    [KTKC-105]I Never Expected My Stepdaughter To Be Such A Busty Little Succubus. Hinata

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-105KTKC105ktkc00105
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-12
    108 min

    [HONB-202]Slime-Slathered Huge Tits - G-Cup Slut

  • censoredbig titsamateurHONBmercurythe first shibuya special f e headquarHONB-202HONB202h-1133honb00202
    • 2021-01-08
    240 min

    [SOUD-023]Aggressive Slut Devours Dick Purely By Instinct In Super Perverted Sex Session!!

  • censoredamateurslutSOUDprestigebest fuckingSOUD-023SOUD023118soud00023
    • 2021-01-08
    139 min

    [IENF-118]Sensitive Nipples Make Her Cum Quickly! Slut With Beautiful Tits Challenged To Thigh Sex! Then Pounded Until She Cums Over And Over Again, Pumped Full Of Creampies!

  • censoredcreampieamateurIENFienergytiger kosakaiienfIENF-118IENF1181ienf00118
    • 2020-12-31
    240 min

    [DVDMS-616]Ordinary Guys And Girls Caught On Camera - Amateur College Couples Separated By A One-Way Mirror Try To Resist Porn Stars' Incredible Sex Techniques! Amateur College Guys (Boyfriends) VS The Actress The Men Of The World Have Fallen In

  • yui hatano censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-616DVDMS616dvdms00616
    • 2020-12-27
    143 min

    [KTKZ-081](Shocking Amateur Videos) Chiharu Is A Reverse Pick Up Tuber Who Loves To Kiss We Seduced Her And Fucked This Slut, Along With All The Other Residents Of Her Shared Living Community House "When I Start Kissing, My Pussy Gets Dripping We

  • censoredamateurslutKTKZkitixx mousouzokushinjinKTKZ-081KTKZ081ktkz00081
    • 2020-12-25
    236 min

    [SIM-103]The Best Friend-With-Benefit Is A Married Woman Whose Husband Is Away - You Don't Even Have To Pay For A Hotel! 13 Shots Of Lush Quickie Cumshots Right At Home

  • censoredcreampiebig titsSIMprestigeamateur pussiesSIM-103SIM103118sim00103
    • 2020-12-12
    143 min

    [YAKO-021]40-Year-Old Slut Has Daily Creampie Sex With Randoms From A Hookup App, Got So Horny She Starred In Porn "My Husband Has No Idea Our K*d Might Not Be His"

  • censoredanalamateurYAKOmercuryshinjuku undergroundYAKO-021YAKO021h-1133yako00021
    • 2020-11-20
    240 min

    [MBM-239]No, No Way...？ A Wife This Ordinary...Total Transformation! Slut! Total Madness!! Unbelievably, A Wild Extreme Unfaithful Fuck! Beautiful Mature Women Lacking Sex 10 Girls SP 4 Hours

  • censoredamateurmature womanMBMprestigegaro sasazukambmMBM-239MBM239118mbm00239
    • 2020-11-19
    302 min

    [KAGP-165]Amateur Girls' Extreme Orgasms From Dildo Masturbation - 25 Girls 2 - It's So Much Bigger Than Their Boyfriends' Cocks! 5 Hours

  • censoredamateurslutKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-165KAGP165kagp00165
    • 2020-11-19
    133 min

    [KTKZ-078]She Can Take Both Hands - Amateur Anal Fisting Slut Shows Her Ultimate O-Face Yumi (41 Years Old)

  • censoredKTKZkitixx mousouzokushinjinKTKZ-078KTKZ078ktkz00078
    • 2020-11-13
    136 min

    [APOD-038]Neat and Clean Community College S*****t Honami-chan (20) Is A Real Sadistic Girl Who Has Wild Sex

  • censoredamateurbeautiful girlAPODapollo daydreamersapollo apollo daydreamersAPOD-038APOD038apod00038
    • 2020-11-12
    116 min

    [NINE-041]A Famous Slut Is Wandering Around Picking Up Guys On The Street With Her Colossal Tits And Cellulite-filled Giant Ass *Hot Pants Widow Towako (35 Years Old)

  • censoredbig titsamateurNINEmercurybrisketchateaubriand hutNINE-041NINE041h-1133nine00041
    • 2020-11-01
    261 min

    [GAV-053]Amateur Self-shot vol. 2

  • censoredslutGAVgogo adult videosGAV-053GAV053gav00053
    • 2020-10-27
    114 min

    [YAKO-018]Barely Avoiding A Ban - Extreme Slut Vlogger Pushes The Limits Of Her Platform 'Bouncing Big Tits' Leaked Unedited Footage From Before Her Account Got Shut Down

  • censoredcreampiebig titsYAKOmercuryshinjuku undergroundYAKO-018YAKO018h-1133yako00018
    • 2020-10-22
    121 min

    [FSDSS-112]Suzume Mino Runs Away!？ Slut Awakening Inspired By A Masochistic Amateur!

  • suzume mino censoredamateurblowjobFSDSSfalenosuisei akaifaleno starFSDSS-112FSDSS1121fsdss00112
    • 2020-10-22
    212 min

    [MADM-132]Forty-something Madam, Follow-up Filming SEX

  • akiyama bookmark sakura riona censoredcreampieamateurMADMcrystal eizotakeshi matsudairamadam maniacMADM-132MADM13249madm00132
    • 2020-10-09
    66 min

    [TG-079](Amateur Video) Secret Tryst With A Horny Married Slut. Two Loads For Her Mouth And Pussy

  • censoredbig titsamateurTG1059 tokyoTG-079TG079h-1304tg00079
    • 2020-10-02
    259 min

    [VPC-002]Leaked Private Footage Of Super Erotic Amateur. A Super Cute Slut's Private Erotic Video 02

  • censoredcreampiebig titsVPCprestigevideo podcastVPC-002VPC002118vpc00002
    • 2020-09-17
    240 min

    [DVDMS-580]A Normal Boys And Girls Focus Group Adult Video A Loving College S*****t Couple Enters The Special Magic Mirror Room And Go Into Separate Rooms To See If They Can Resist The Amazing Techniques Of Our Adult Video Actress And Actor!! A Super

  • hasumi claire censoredcreampieamateurDVDMSdeep sfunky hasegawaDVDMS-580DVDMS580dvdms00580
    • 2020-09-13
    139 min

    [BAHP-047]I Want To Perform In An Adult Video This Amateur Came In For An Interview 09 - Ayami-san Is An Orgasmic Office Lady Who Came In For An Adult Video Interview -

  • censoredamateurslutBAHPbaltandaibutsu yoshidahoppinBAHP-047BAHP047bahp00047