jav schoolgirl high vision censored grimosa




FC2CESDNGODSHKDBBANMIDENNPJAVSAAUKGWAAAAPODJUFEVENXCAWDSSISADNHDKAMIDVAWDMEYDVEMA

2022-02-04
120 min

[SSIS-317]The Eve Of My Graduation Ceremony, With My Homeroom Teacher For Whom I Was Filled With Daydreams, Love And Desire For 3 Years - Miru

  • miru censoreduniformschoolgirlSSISs1 no 1 styleinaballSSIS-317SSIS317ssis00317
    • 2021-12-24
    150 min

    [SSIS-282]My Usually Quiet S*****t Seduces Me With Her Panting With Conviction Only In Front Of Me.

  • kosui jun censoreduniformschoolgirlSSISs1 no 1 styletrendy yamaguchiSSIS-282SSIS282ssis00282
    • 2021-07-02
    119 min

    [SSIS-112]Gorgeous Teen In Uniform Loves 4 Older Guys - Three Immoral Fucks And Passionate Blowjobs Kozue Fujita

  • kozue fujita censoreduniformschoolgirlSSISs1 no 1 styleoosaki hirokoujiSSIS-112SSIS112ssis00112
    • 2021-06-16
    119 min

    [SSIS-095]Taken Over By A Mania For Track And Field Y********l In A School Uniform Has Secretly Filmed Bizarre Footage Of Her Taken By A Stalker Leaked Izuna Maki

  • izuna maki censoredschoolgirlsingle workSSISs1 no 1 stylegoemonSSIS-095SSIS095ssis00095
    • 2021-04-14
    120 min

    [SSIS-044]Lured By (Panty Shots, Thighs, Whispered Seduction). Giving In To The Temptation Of My Own S*****ts - After School At A Love Hotel, Day After Day, Forbidden Sex... Izuna Maki

  • izuna maki censoreduniformschoolgirlSSISs1 no 1 styleichigoharaSSIS-044SSIS044ssis00044
    • 2021-03-18
    146 min

    [SSIS-018]Step Sibling Sexual Tension Explodes After 12 Years And They Spend Three Days Fucking Like Crazy Izuna Maki

  • izuna maki censoreduniformschoolgirlSSISs1 no 1 styletake dSSIS-018SSIS018ssis00018
    • 2021-02-06
    150 min

    [SSNI-988]They Hooked Up Online - Secret Tryst Between A Slutty S********l And An Older Guy Obsessed With School Uniforms Sayaka Otoshiro

  • otoshiro sayaka censoredschoolgirlbeautiful girlSSNIs1 no 1 stylefamSSNI-988SSNI988ssni00988
    • 2020-12-31
    118 min

    [SSNI-958]Stuck At School Overnight With The Teacher I Hate Because Of A Storm... It's Just The Two Of Us And My Clothes Are Soaked - The Gross Old Perv Can See Everything - But There Was Nowhere Else To Go, So He Wound Up Fucking Me Until I Came

  • kodama rena censoredbig titsuniformSSNIs1 no 1 styletrendy yamaguchiSSNI-958SSNI958ssni00958
    • 2020-11-19
    118 min

    [SSNI-923]Teen Girl In School Uniform Spends Her Last Year Until Graduation Having Perverted Sex With The Teacher She Disliked - Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingschoolgirlSSNIs1 no 1 styleamazing meatSSNI-923SSNI923ssni00923
    • 2020-10-17
    117 min

    [SSNI-890]Real Uniform Stalker - Waiting For A Downpour To Strike Aika Yumeno

  • yumeno aika censoredbig titsschoolgirlSSNIs1 no 1 styledragon nishikawaSSNI-890SSNI890ssni00890
    • 2020-10-03
    119 min

    [SSNI-882]Yumi This Is A School! She's Climbing The Steps Of Adulthood And Now Her Voluptuous Body Is Bursting Out Of Her Uniform, But She's Both Healthy And Filthy At The Same Time And So Innocent, And That Makes Her Just My Type Shion Yumi

  • evening beauty censoredbig titsuniformSSNIs1 no 1 stylezaku araiSSNI-882SSNI882ssni00882
    • 2020-09-17
    120 min

    [SSNI-870]My Step-Niece, Who Is Going Through Puberty, Takes My Cock Into Her Mouth Like A TSUNDERE Slut Every Time Our Eyes Meet, Even In Situations Where We Can't Afford To Get Caught - Mako Ito

  • iga mako censoredschoolgirlbeautiful girlSSNIs1 no 1 stylekitorune kawaguchiSSNI-870SSNI870ssni00870
    • 2020-09-17
    155 min

    [SSNI-874]Uniformed Hot Girl Devil Fuck! Giant Cock Shoved Into Izuna Maki's Young Body

  • izuna maki censoredschoolgirlbeautiful girlSSNIs1 no 1 styleamazing meatSSNI-874SSNI874ssni00874
    • 2020-06-06
    118 min

    [SSNI-796]Trapped At School Because Of A Typhoon, Unable To Go Home, A S*****t And Teacher Cross The Line During One Stormy Night Shion Yumi

  • evening beauty censoredbig titsschoolgirlSSNIs1 no 1 stylebungo maedaSSNI-796SSNI796ssni00796
    • 2020-06-06
    153 min

    [SSNI-798]She Became The Target Of A Track & Field Freak... These S*********ls In Uniform Were Exposed By Peeping Videos Filmed By A Relentless Nutjob Rin Kira

  • kira rin censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-798SSNI798ssni00798
    • 2020-04-16
    147 min

    [SSNI-758]This Year, I Was Targeted Once Again By Someone Crazy About School Swimsuits... This Barely Legal Girl With Big Tits Fell Prey To The Twisted Love Of A Perverted Stalker Who Suddenly Got Serious Aika Yumeno

  • yumeno aika riona suzujo censoredbig titsschoolgirlSSNIs1 no 1 styledragon nishikawaSSNI-758SSNI758ssni00758
    • 2020-03-14
    118 min

    [SSNI-734]When It Became Impossible To Go Home During A Typhoon-Filled Night, This S*****t And Teacher Crossed The Line Into Crazed Ecstasy Yura Kano

  • yura kanno censoredschoolgirlbeautiful girlSSNIs1 no 1 stylebungo maedaSSNI-734SSNI734ssni00734
    • 2020-03-14
    150 min

    [SSNI-730]Don't Hate Us Because We're Horny - A Female Manager Has Sweaty Sex With Her Entire Team For 3 Days And 2 Nights On A Summer Getaway - Yua Mikami

  • yua mikami censoredbig titsschoolgirlSSNIs1 no 1 stylemon cSSNI-730SSNI730ssni00730
    • 2020-03-05
    119 min

    [SSNI-725]A S********l Gets A Lusty And Musty Breaking In Training Session She Gets Continuously Fucked By Middle-Aged Creeps With School Uniform Fetishes... Rin Kira

  • kira rin censoreduniformschoolgirlSSNIs1 no 1 stylesuisei akaiSSNI-725SSNI725ssni00725
    • 2020-02-15
    147 min

    [SSNI-705]Our Manager Likes To Get Lotioned Up And Serve Us! Big-Titted Manager Aika Yumeno

  • yumeno aika censoredbig titsschoolgirlSSNIs 1 number one styletake ds1 no 1 styleSSNI-705SSNI705ssni00705
    • 2020-02-01
    120 min

    [SSNI-697]A Fallen Honor S*****t - She Gets Subjected To Rough Sex Until She Likes It - Riko Shiraha

  • riko shirahaba censoredschoolgirlbeautiful girlSSNIs1 no 1 stylekitorune kawaguchiSSNI-697SSNI697ssni00697
    • 2019-09-14
    116 min

    [SSNI-573]The Targets Are School Girls In Uniform Mako Is Starring In A Shameful Group Molestation Special She Was Soiled By The Distorted Love Of A Middle-Aged Teacher... Mako Iga

  • iga mako censoredschoolgirlsingle workSSNIs1 no 1 stylemametaro mamezawaSSNI-573SSNI573ssni00573
    • 2019-09-05
    157 min

    [SSNI-560]Total Domain Tall Girl Flashes Her Sexy Legs - A Nympho In Knee Highs Hotaru Nogi

  • nogi firefly censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-560SSNI560ssni00560
    • 2019-08-16
    119 min

    [SSNI-546]She Was One Grade Above Him, And He Always Admired This Madonna From Afar, But Now, On This Club Field Trip, They Were Sharing The Same Room, For The 3 Days Straight. Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSSNIs1 no 1 stylejo styleSSNI-546SSNI546ssni00546
    • 2019-08-16
    162 min

    [SSNI-550]This Tsundere Little Sister-In-Law Is Prancing Around Without A Care In The World, Flashing Panty Shot Temptation Every Day Mako Iga

  • iga mako censoredschoolgirlsisterSSNIs1 no 1 stylekyoseiSSNI-550SSNI550ssni00550
    • 2019-08-03
    118 min

    [SSNI-536]My Girlfriend's Younger Sister Seduces Me With Her Massive Tits And No Bra, And I Fall For It - Hotaru Nogi

  • nogi firefly censoredbig titsschoolgirlSSNIs1 no 1 stylekyoseiSSNI-536SSNI536ssni00536
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-07-13
    147 min

    [SSNI-524]Breaking In A Female Student In Uniform. Continuously Fucked By Middle-Aged Fanatics... Mako Iga

  • iga mako censoredschoolgirlsingle workSSNIs1 no 1 styleamazing meatSSNI-524SSNI524ssni00524
    • 2019-07-04
    147 min

    [SSNI-510]Colossal Tits Schoolgirl in Uniform Completely Tied Up And Forcibly Violated, Shion Yumi

  • evening beauty censoredbig titsschoolgirlSSNIs1 no 1 styleamazing meatSSNI-510SSNI510ssni00510
    • 2019-06-01
    119 min

    [SSNI-487]Sensitive Girl In A School Uniform Begs To Be Molested I Only Wanted To Try It Out But It Feels So Good I Can't Stop... Miru Sakamichi

  • see the slope censoredsquirtingschoolgirlSSNIs1 no 1 stylemametaro mamezawaSSNI-487SSNI487ssni00487
    • 2019-05-04
    167 min

    [SSNI-471]Big Tits Schoolgirl Raped And Forced To Cum Hotari Noki

  • nogi firefly censoredbig titssquirtingSSNIs1 no 1 stylebungo maedaSSNI-471SSNI471ssni00471
    • 2019-04-13
    120 min

    [SSNI-460]Her Looks Of Hatred And Sensitive Body Are Too Much To Handle So I Relentlessly Pound This Uniformed School Girl From All Directions Mei Hata

  • field mei censoredschoolgirldeepthroatSSNIs1 no 1 styleichigoharaSSNI-460SSNI460ssni00460
    • 2019-04-04
    173 min

    [SSNI-447]Sex-Loving Miru Sakamichi's Horny, Erotic Massage Parlor Special With Lots Of Ejaculations ~Dedicated Service, 170-Minute VIP Course

  • see the slope censoredsquirtingschoolgirlSSNIs1 no 1 styleusa pyonSSNI-447SSNI447ssni00447
    • 2019-04-04
    158 min

    [SSNI-448]My Girlfriend's Little Sister Seduces Me With Her Bra-Less I-Cup Tits And I Can't Resist Her. Shion Yumi

  • evening beauty censoredbig titsschoolgirlSSNIs1 no 1 stylekyoseiSSNI-448SSNI448ssni00448
    • 2019-03-16
    164 min

    [SSNI-436]Filthy, Steamy Sex In A Tiny Apartment With A Beautiful Young Girl In Uniform One Tranquil Afternoon... She Skipped Class And Came To This Cramped Apartment Filled With The Smell Of Sweat And Bodily Fluids, And With Fear, Trepidation, Lust,

  • there is hashimoto censoreduniformschoolgirlSSNIs1 no 1 stylebungo maedaSSNI-436SSNI436ssni00436
    • 2019-03-06
    131 min

    [SSNI-428]Completely Surrounded And Molested By A Group, This Busty Schoolgirl Can't Even Resist, Shion Yumi

  • evening beauty censoredbig titsschoolgirlSSNIs1 no 1 styleamazing meatSSNI-428SSNI428ssni00428
    • 2019-02-16
    178 min

    [SSNI-412]I Want You To Flash Your Panties At Me While Looking At Me With Disdain. Aika Yumeno

  • yumeno aika censoredbig titsschoolgirlSSNIs1 no 1 stylekyoseiSSNI-412SSNI412ssni00412
    • 2018-12-13
    174 min

    [SSNI-373]The Brutal Gang Rape Of A Female Student ~An Honor Student Is Targeted By Intruders And Used As A Sex Slave~ Yura Kano

  • yura kanno censoredschoolgirlsingle workSSNIs1 no 1 stylejo styleSSNI-373SSNI373ssni00373
    • 2018-12-06
    119 min

    [SSNI-363]A Schoolgirl In Uniform Gets Raped. Azusa Oto. ~The Fate of A School Idol Desperate To Keep A Secret~ Azusa Oto

  • sound azusa censoredbeautiful girldeepthroatSSNIs1 no 1 stylejo styleSSNI-363SSNI363ssni00363
    • 2018-08-16
    151 min

    [SSNI-286]School Girls in Uniform Forced Consecutive Full Molester Train Yura Kano

  • yura kanno censoredschoolgirlbeautiful girlSSNIs1 no 1 stylejo styleSSNI-286SSNI286ssni00286
    • 2018-03-10
    154 min

    [SSNI-150]Breaking In An Exposed And Shaved Pussy Big Tits School Girls in Uniform Endured Torture & Rape By Rough Sex Loving Brutes Koharu Suzuki

  • suzuki koharu censoredbig titssquirtingSSNIs1 no 1 stylejo styleSSNI-150SSNI150ssni00150
    • 2017-11-18
    119 min

    [SSNI-058]A Dripping Wet No Bra Busty Schoolgirl The Temptation Of Dripping Wet See Through Pink Nipples Aika Yumeno

  • yumeno aika censoredbig titsschoolgirlSSNIs1 no 1 stylekyouseiSSNI-058SSNI058ssni00058
    • 2017-10-28
    150 min

    [SSNI-036]The Alluring Total Domain Schoolgirl Enjoy Miniskirt, Knee-High Socks, And Flashes Of Bare Legs Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemonSSNI-036SSNI036ssni00036
    • 2017-10-14
    117 min

    [SSNI-025]Schoolgirl Beautiful Tits Nip Slips Sakura Miura

  • minamata sakura censoredbig titsschoolgirlSSNIs1 no 1 stylemishimaroku saburouSSNI-025SSNI025ssni00025
    • 2017-10-14
    147 min

    [SSNI-024]Schoolgirl Sex They Cannot Resist When Forced And Tied Up Against The Molester Ann Tsujimoto

  • an tsujimoto censoredschoolgirlsingle workSSNIs1 no 1 styleaizome tomohisaSSNI-024SSNI024ssni00024
    • 2017-09-09
    154 min

    [SNIS-992]Schoolgirl Rough Sex Gang Bang Rape A Student Council President Targeted As A Cum Bucket Arina Hashimoto

  • there is hashimoto censoredsquirtingschoolgirlSNISs1 no 1 stylejo styleSNIS-992SNIS992snis00992
    • 2017-06-24
    146 min

    [SNIS-946]A Little Devil JK Who Lures Me To Temptation With Panty Shot Action Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSNISs1 no 1 styletaro ryogokuSNIS-946SNIS946snis00946
    • 2017-06-10
    162 min

    [SNIS-933]A Hairless Schoolgirl Who Was Totally Tied Up In S&M Bondage And Force Fucked Ann Tsujimoto

  • an tsujimoto censoredschoolgirlbdsmSNISs1 no 1 stylekyoseiSNIS-933SNIS933snis00933
    • 2017-06-01
    122 min

    [NHDTA-995]The Train Riding Creampie Molester She Hates It, But She Shamefully Holds On Tight To Her Molester Teachers As She Goes Cum Crazy

  • censoredcreampieschoolgirlNHDTAnatural highwhen viewNHDTA-995NHDTA9951nhdta00995
    • 2017-05-03
    123 min

    [NHDTA-983]I Refuse To Cum When The Train Molester Touches Me... This Schoolgirl Tries To Resist But Shakes Her Ass In Pleasure And Pisses Herself Silly 2

  • censoredschoolgirlNHDTAnatural highbacon tanakaNHDTA-983NHDTA9831nhdta00983
    • 2017-04-27
    118 min

    [SNIS-900]At The Library, Unable To Scream Or Resist, She Gave In To The Molester... Aika Yumeno

  • yumeno aika censoredbig titsschoolgirlSNISs1 no 1 styleSNIS-900SNIS900snis00900
    • 2017-04-27
    120 min

    [SNIS-905]Strolling Schoolgirl Suzu Takachiho

  • takachiho tin censoredschoolgirlbeautiful girlSNISs1 no 1 styleSNIS-905SNIS905snis00905
    • 2017-04-02
    118 min

    [SNIS-887]A Schoolgirl In A Packed Molester Train Moe Amatsu

  • angel moe censoredsquirtingschoolgirlSNISs1 no 1 stylemichiru arashiyamaSNIS-887SNIS887snis00887
    • 2017-03-11
    121 min

    [SNIS-866]Schoolgirl Walk - Miharu Usa

  • miharu hanasaki censoredbig titsschoolgirlSNISs1 no 1 styletakuanSNIS-866SNIS866snis00866
    • 2017-02-11
    178 min

    [SNIS-846]All POV NTR Videos These Ravaged Schoolgirls Are Being Fucked By Dirty Old Men While Begging You For Help Ann Tsujimoto

  • an tsujimoto censoredschoolgirlbeautiful girlSNISs1 no 1 styledirector jo styleSNIS-846SNIS846snis00846
    • 2017-02-11
    119 min

    [SNIS-843]I Can See My Little Sister's Beautiful Tits Miharu Usa

  • miharu hanasaki censoredbig titsschoolgirlSNISs1 no 1 stylekyouseiSNIS-843SNIS843snis00843
    • 2017-01-28
    146 min

    [SNIS-826]She's Unable To Resist The Ecstasy/Squirting/Spasmic Orgasms Minami Kojima

  • minami kojima censoredsquirtingschoolgirlSNISs1 no 1 styledirector jo styleSNIS-826SNIS826snis00826
    • 2017-01-12
    149 min

    [SNIS-819]Schoolgirl Walk, An Tsujimoto

  • an tsujimoto censoredschoolgirlbeautiful girlSNISs1 no 1 stylehasami kukaSNIS-819SNIS819snis00819
    • 2016-12-08
    246 min

    [NHDTA-914]Both-Sex Molesters

  • censoredbig titsschoolgirlNHDTAnatural highitaka sumithrin powderNHDTA-914NHDTA9141nhdta00914
    • 2016-12-08
    245 min

    [NHDTA-915]Don't Make A Sound 19 Fully Naked Creampie Of Shame Special

  • censoredcreampiebig titsNHDTAnatural highitaka sumithrin powderNHDTA-915NHDTA9151nhdta00915