jav upskirt schoolgirl high vision




FC2SSISHMNDASDGMEMMILKCAWDSPRDMIDVSSNIHDKASTARSNACXFSDSSAPODROYDMARAHZGDHNDSANGVH

2018-12-01
163 min

[MMUS-028]A Little Devil Tempting Beautiful Girl Tsubasa Hachino

  • yano tsubasa censoredschoolgirlbeautiful girlMMUSmarrionkijin kasaikcpMMUS-028MMUS028mmus00028
    • 2018-11-16
    210 min

    [DOCP-107]My Friend's JK Little Sister Was Smiling Devilishly As She Lured Me To Temptation With Panty Shot Action! She Gave Me A Furious Face Ride With Her Musty Panties And Then She Teased Me With A Horny Hot Dogging Session...

  • yui natsuhara suzu yamai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-107DOCP107118docp00107
    • 2018-11-08
    190 min

    [SW-592]Crazy Temptation Battle Between Cousins. Meeting My Cousins After A Long Time, I Find Out They've Grown And Have Hot Bodies. They Use Their Sexy Asses To Try To Seduce Me.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-592SW5921sw00592
    • 2018-11-08
    136 min

    [IENE-943]I Was Laid Up With A Cold When My Classmates Came To Tempt Me With Panty Shots.

  • aya miyazaki ichinose love censoredschoolgirlIENEienergyrakudaie nergyIENE-943IENE9431iene00943
    • 2018-11-08
    141 min

    [MIST-235]The Special Service At The Schoolgirl Observation Club 4. Yui Tomita

  • yu tomita censoredschoolgirlsingle workMISTmr michirusaitaMIST-235MIST2351mist00235
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2018-10-28
    137 min

    [MMUS-027]A Tempting Little Devil Beautiful Girl

  • mitsuki kamiya censoredschoolgirlbeautiful girlMMUSmarrionkijin kasaikcpMMUS-027MMUS027mmus00027
    • 2018-10-21
    120 min

    [KAWD-946]The Beautiful, Seductive Girl Who Tempts Me By Flashing Her Panties At Me. Ruru Arisu

  • have censoredschoolgirlslutKAWDkawaiigoemonKAWD-946KAWD946kawd00946
    • 2018-10-12
    317 min

    [SCPX-307]Glans Covered In Pre-Cum From Naughty Girl's Pantyshots - Provocative Collection! She Lets Me Go All The Way To Creampie Sex! 15 Stories of Miraculous Situations, 5 Hours

  • censoredcreampieschoolgirlSCPXscoopmousouzokuSCPX-307SCPX307h-565scpx00307
    • 2018-10-11
    155 min

    [SW-586]I'm Going To Roast You Like A Pig! A Glaring Delinquent Schoolgirl And Me. But She's Really Cute And She Gets All Sweet When She's Alone. She's Really A Sheep In Wolf's Clothing And She Can't Say No To Pleasure.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-586SW5861sw00586
    • 2018-10-11
    208 min

    [SW-587]My Parents Remarried, And I Got A Devilish Little Sister High School Girl Who Sure Loves Her Older Brother! I've Fallen For That Body That's Working So Hard To Seduce Me. Miyuka Araka.

  • arisaka miyuki censoredschoolgirlsisterSWswitchlight fujimaswitch switchSW-587SW5871sw00587
    • 2018-10-11
    127 min

    [IENE-934]I Stayed Home Because Of A Cold And My Sister's Classmates Are Teasing Me And Seducing Me By Flashing Their Panties At Me.

  • nanami yua hatsuse kanon censoredschoolgirlIENEienergyrakudaie nergyIENE-934IENE9341iene00934
    • 2018-10-07
    223 min

    [HUNTA-501]This Naive Girl Said That She Was A Slut, So When I Egged Her On, I Was Able To Fuck Her! There's This Bitchy Girl In My Class Who Pretends To Be A Slut But Even A Cherry Boy Like Me Can Tell That She's Not Really A Slut She Kept O

  • censoredschoolgirlHUNTAhuntermorikihhh groupHUNTA-501HUNTA501hunta00501
    • 2018-10-07
    102 min

    [SLAP-041]These Schoolgirls Want You To See Their Dripping Wet Camel Toe. 4

  • censoredschoolgirlSLAPdigital arkdigital ark digital arkSLAP-041SLAP041slap00041
    • 2018-10-07
    216 min

    [HUNTA-502]I Can't Believe I'm Living Together With My Cousin Who Ran Away From Home？ I'm Not Used To Living Together With A Girl, And Now I Can't Masturbate With Her Around So My Crotch Is About Ready To Explode! But Then... I Live A

  • censoredschoolgirlhandjobHUNTAhuntercognac kaminohhh groupHUNTA-502HUNTA502hunta00502
    • 2018-10-07
    240 min

    [DVDMS-317]A Normal Boys And Girls Focus Group AV We Negotiated With This Boy And His Female Classmate As They Were Walking Home From School! "Would You Help Your Cherry Boy Friend With His Masturbation？" The Cutest Girl In Class Is Bashfully

  • censoredschoolgirlamateurDVDMSdeep scherie komabaDVDMS-317DVDMS317dvdms00317
    • 2018-10-05
    120 min

    [TWT-025]Girls In Uniform Who Love Masturbation Are Luring You To Panty Shot Dirty Talk Temptation

  • censoredschoolgirllingerieTWTsarutoru video publishertwin tailsTWT-025TWT025h-897twt00025
    • 2018-09-02
    126 min

    [SLAP-040]Panty Shot Company 9

  • censoredschoolgirlSLAPdigital arkupdatingSLAP-040SLAP040slap00040
    • 2018-06-15
    336 min

    [HUNTA-461]"Hey Big Brother, Why Are You Touching My Flat Titties？？" My Schoolgirl Little Sister Is Seriously Cute, But Lately, I've Noticed A Bulge Growing In Her Chest, And I've Gotta Say, She's Just My Type!! She's Got A G

  • censoredsisterHUNTAhunterborubo nakanoHUNTA-461HUNTA461hunta00461
    • 2018-05-04
    212 min

    [GDHH-101]I Transferred To This New School Where It Was All About "Ultra Cool Biz!" All The Students And Teachers Are Showing Off Their Bellies! Panty Shot Action Galore! An Ultra Mini Mini Uniform Action With Tits Practically Showing To Get

  • miyu saito the starry sky censoredschoolgirlGDHHgolden timekorosukehhh groupGDHH-101GDHH101gdhh00101
    • 2018-04-07
    167 min

    [MIDE-539]My Little Sister Is Luring Me To Temptation With All Her Might, Smiling And Flashing Me Panty Shot Action Mia Nanasawa

  • nanasawa mia censoredschoolgirlbeautiful girlMIDEmoodyzgoemonmoodyz divaMIDE-539MIDE539mide00539
    • 2018-03-21
    183 min

    [SW-546]Hmmm, Do You Enjoy Looking At My Panties？ Every Day After Work, I Stop By This Cafe, And I Thought I Was Seeing This Schoolgirl's Panty Shot Action By Accident, But Then She Bashfully Began Flashing Her Panties At Me On Purpose Ai Hoshina

  • sena ai censoredschoolgirlsingle workSWswitchraito fuji makotoSW-546SW5461sw00546
    • 2018-02-22
    223 min

    [SW-540]This Schoolgirl In Knee High Socks Who I Would See Every Morning Was Flashing Panty Shot Action At Me And It Was So Cute That She Got My Dick Hard, And She Squealed, "You're Such A Pervert!" And Puffed Up Her Cheeks In Anger But S

  • sena ai censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-540SW5401sw00540
    • 2018-02-16
    240 min

    [GDHH-092]No Matter How Old She Gets, My Innocent Childhood Friend Likes To Play Pranks (Wrestling, Gas Pedaling My Balls, etc) On Me, And It Gets Really Rock Hard!!! Before I Knew It, She Was The Most Popular Girl In Class, And I Became A Wallflower

  • censoredschoolgirlGDHHgolden timerobby kunhhh groupGDHH-092GDHH092gdhh00092
    • 2018-02-02
    120 min

    [DOKS-420]Alluring Temptation Panty Shot Rhythm

  • sakura chinami madoka ibuki censoredschoolgirlblowjobDOKSoffice k sforever youngDOKS-420DOKS42036doks00420
    • 2017-12-21
    150 min

    [SW-527]If You Wanna See So Bad, I'll Show You! Schoolgirl Babes Love To Face Ride And Say, I Love You. My Sister And Her Friends Came Over To Play And Tease Me With Panty Shot Action, And They Smiled And Let Me Bury My Face In Their Schoolgirl A

  • censoredschoolgirlSWswitchraito fuji makotoSW-527SW5271sw00527
    • 2017-12-17
    243 min

    [HUNTA-389]Do Girls Drop Their Guard Underneath The Foot Warmer？ It Was Panty Shot Heaven! One Cold Day, My Little Sister Brought Her Friends Over They All Huddled Together In The Foot Warmer Doing Their Homework, And I Decided To Take A Peek. And I

  • censoredschoolgirlsisterHUNTAhunterkawajiriHUNTA-389HUNTA389hunta00389
    • 2017-12-07
    240 min

    [SW-524]My Classmate Has Some Juicy Looking Thighs, And When I Got A Peek Underneath Her Skirt, I Realized She Was Wearing A Thong! 2 A Schoolgirl In Knee High Socks And A Thong Is Breathing Sweet Nothings Into My Ears

  • censoredschoolgirlSWswitchraito fuji makotoSW-524SW5241sw00524
    • 2017-12-07
    160 min

    [HBAD-395]This Schoolgirl Is Secretly Luring Her Cousin To Temptation With Her Bulging Panties, Behind Her Mother's Back Aoi Kururugi

  • aoi kururugi censoredschoolgirlsingle workHBADhibinoraito fuji makotoHBAD-395HBAD3951hbad00395
    • 2017-11-19
    92 min

    [KCDA-200]She's Wriggling Her Hot Body In Panty Shot Temptation Super Mini Skirt High School Girls

  • censoredschoolgirlKCDAdigital arkdigital ark digital arkKCDA-200KCDA200kcda00200
    • 2017-11-13
    232 min

    [HUNTA-375]When This Horny Slut Joined The Club, All The Female Members Turned Into Sluts Too! The Literary Club Is Filled With Innocent And Proper Boys And Girls And Now A Slut Has Become The Newest Member!! When She Started Seducing The Male Member

  • censoredschoolgirlHUNTAhuntermorikiHUNTA-375HUNTA375hunta00375
    • 2017-11-04
    140 min

    [KAGP-024]My Nickname Is "The Professor" I'm A Weakling And A Loser With The Ladies, But One Day A Girl From Class Came To My House So We Watched AV Videos Together Her Panties Got Dripping Wet Just From Watching These Videos, So I Knew S

  • censoredcreampieschoolgirlKAGPkaguya hime pt mousozokuno tonKAGP-024KAGP024kagp00024
    • 2017-11-04
    331 min

    [HUNTA-368]"Hey, Did Our Lips Just Touch？" "What, Really!？" We're Getting Seriously Up Close And Personal! A Secret Kiss Underneath The Futon! My Childhood Friend Is Trying To Cheer Me Up! We Were Always Great Friends Since Kinder

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-368HUNTA368hunta00368
    • 2017-10-28
    150 min

    [SSNI-036]The Alluring Total Domain Schoolgirl Enjoy Miniskirt, Knee-High Socks, And Flashes Of Bare Legs Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemonSSNI-036SSNI036ssni00036
    • 2017-10-19
    215 min

    [SW-515]Every Morning I See This Schoolgirl In Her Knee-High Socks, Flashing Her Thighs And Panty Shot Action At Me, And She's So Cute It Makes My Dick Hard, But Then She Gets Mad And Says, "You're Such A Pervert, Big Brother!" But Th

  • censoredschoolgirlsingle workSWswitchraito fuji makotoSW-515SW5151sw00515
    • 2017-10-13
    173 min

    [VRTM-297]"I Always Wanted To Have A Chance At Groping Her Ass!" This Horny Big Brother Drugged His Big Ass Schoolgirl Sister With Sleeping Pills, And Now He's Living The Dream Of Creampie Sex With Her Full And Voluptuous Ass! 2

  • minori otani azuki censoredcreampieschoolgirlVRTMv r producesunao tanakaVRTM-297VRTM297h-910vrtm00297
    • 2017-10-13
    172 min

    [VRTM-294]We Slipped Some Aphrodisiacs To A Panty Shot Flashing Schoolgirl In A Miniskirt, And She Started Rubbing Her Knee High Socks Together And Wet Her Panties, And Scissor Locked Us In Her Legs And Begged Us To Creampie Her! 3

  • miki aise rina minami censoredcreampieschoolgirlVRTMv r producetiger kosakaiVRTM-294VRTM294h-910vrtm00294
    • 2017-09-03
    199 min

    [GDHH-069]My Childhood Friend's Always Coming Over Uninvited To Make Fun of Me! This Time She Finds My Porn and Says It's All Fake, But As She Watches, She Starts to Fidget. I Give Her a Little Poke and She Immediately Reacts？! I Try Going Fo

  • censoredschoolgirlGDHHgolden timekiteretsuGDHH-069GDHH069gdhh00069
    • 2017-07-20
    192 min

    [DANDY-560]"If You Saw These JK Sisters Deeply Interested In Tasting Some Adult Cock Flashing Double Panty Shot Temptation... Which One Would you Take？" vol. 1

  • censoredschoolgirlsisterDANDYdandytenderloin nakamoriDANDY-560DANDY5601dandy00560
    • 2017-07-08
    116 min

    [ARM-615]A Perverted Attraction Show - You Can See Girls' Panties at this Fake Storefront 2

  • miyu saito chuncheon serase censoredbig titsschoolgirlARMaroma planningdont knowaromaARM-615ARM615arm00615
    • 2017-07-06
    167 min

    [SW-494]After This Schoolgirl Kept Flashing Her Panties At Me And I Could No Longer Resist, She Secretly Kept Cumming At Me For Sex, And Since I Had No Other Choice, I Fucked Her

  • censoredschoolgirlslutSWswitchlight fujimaswitch switchSW-494SW4941sw00494
    • 2017-06-24
    146 min

    [SNIS-946]A Little Devil JK Who Lures Me To Temptation With Panty Shot Action Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSNISs1 no 1 styletaro ryogokuSNIS-946SNIS946snis00946
    • 2017-05-26
    173 min

    [SCPX-204]"Do boys really like it when girls flash their panties？" the girls ask me. I don't talk much, which makes me the perfect crash test dummy for the girls in my class that want to try out sexual stuff. They call me a freak and a pe

  • censoredcreampieschoolgirlSCPXscoopkijin kasaimousouzokuSCPX-204SCPX204h-565scpx00204
    • 2017-05-11
    119 min

    [MIAE-057]Total Domain A Schoolgirl In Beloved Knee High Socks Yuka Hodaka

  • yuka hotaka censoredschoolgirlbeautiful girlMIAEmoodyzMIAE-057MIAE057miae00057
    • 2017-04-20
    208 min

    [SW-479]You Like My Ass, Don't You？ This Schoolgirl Little Sister Loves Her Big Brothers, So She's Always Prancing Around Wearing Nothing But Bloomers, Or White Panties, Or Mini Tights, Or Swimsuits, Or Thongs, So She Can Show Off Her Pretty

  • shiina sky censoredsistersingle workSWswitchlight fujimaswitch switchSW-479SW4791sw00479
    • 2017-03-24
    147 min

    [MDTM-234]Schoolgirl Panty Shot Temptation, Spoiled Pervert Azuki Turns You On When She Shows Off Her Hot Bod

  • azuki censoredcreampieschoolgirlMDTMmedia station96uchu kikakuMDTM-234MDTM23461mdtm00234
    • 2017-03-10
    189 min

    [VRTM-241]His New Daughter Is A Young Schoolgirl But She's Got An Adult Sized Big Ass Perfect For Birthing Babies! When She Seduces Him With Her Panty Shots, Her Father-In-Law Loses His Mind And Starts Raw Pumping His Cock Inside Her! Making Sure

  • azuki blue censoredcreampieschoolgirlVRTMv amp r produceVRTM-241VRTM241h-910vrtm00241
    • 2017-02-19
    239 min

    [HUNTA-265]The Bullies Suggested That I Become Invisible, So I Did It And Since Nobody Else Wanted To End Up Like Me, No One Would Ever Talk To Me Anymore Nobody Would Acknowledge My Presence So Whenever I Stood Up From My Seat, Girls Would Sit At My

  • censoredcreampieschoolgirlHUNTAhuntermorikiHUNTA-265HUNTA265hunta00265
    • 2017-02-18
    300 min

    [KAR-851]We Secretly Shot Peeping Videos Of That Famous Cram School Teacher During His Private Sessions! Innocent And Pure Schoolgirl Babes In A Cram School Panty Shot Video

  • censoredschoolgirlKARkarmadont knowtosatsuKAR-851KAR851kar00851
    • 2017-02-10
    136 min

    [FSKT-007]A JK Fetish Photo Shoot With Shizuka And Her H Cup Tits

  • censoredbig titsschoolgirlFSKTfirst starupdatingFSKT-007FSKT007h-491fskt00007
    • 2017-02-05
    242 min

    [GDHH-041]My Childhood Friend Is Having An Orgasm With Her Vibrator!？ My Childhood Friend Is Always Barging Into My Room And Making Fun Of Me For Being A Cherry Boy! Finally She Pissed Me Off One Time Too Many, So I Got Revenge By Giving Her The Elec

  • censoredschoolgirlGDHHgolden timebenzo sanhhh groupGDHH-041GDHH041gdhh00041
    • 2017-02-02
    210 min

    [SW-464]Don't Look At Her Panties! When His Little Sister Was Hanging With Her Friends, She Caught Her Big Brother Peeking At Their Panties "I Hate You!" But Then, She Said, "You Only Get To Look At My Panties"

  • censoredschoolgirlsisterSWswitchraito fuji makotoSW-464SW4641sw00464
    • 2017-01-08
    120 min

    [ARM-564]A Sudden Panty Shot Got Me Hard, So I Secretly Beat Off. Part 9 12

  • nozomi hazuki oba yui censoredschoolgirlslutARMaroma planningdont knowaromaARM-564ARM564arm00564
    • 2016-12-22
    450 min

    [SW-454]This Is The Story Of A Schoolgirl Panty Peep Show, And The Girls Who Bashfully Looked Me In The Eye Deluxe Edition

  • censoredschoolgirlSWswitchraito fuji makotoSW-454SW4541sw00454
    • 2016-11-08
    175 min

    [ARMG-273]Schoolgirls Giving You A Peak At The Culture Day Snack Booth - Schoolgirl Cafe VIII

  • miku abe azuki censoredschoolgirlcosplayARMGaroma planningaroma g 18ARMG-273ARMG273armg00273
    • 2016-11-04
    245 min

    [HUNTA-221]Unbelievable! My Sis Had Tiny Titties Through Middle School, But When I Thought They'd Gotten Bigger At School, She'd Already Become A Famous Slut In Our Town! Of Course, Her Slutty Friend With Big Tits Came To Hang Out In Our Shar

  • censoredbig titsschoolgirlHUNTAhunterkawajirihhh groupHUNTA-221HUNTA221hunta00221
    • 2016-10-20
    124 min

    [ARMG-274]エッチなJKの挑発女体図鑑

  • miho sanada miku abe censoredschoolgirlARMGaromakikakuaromag 18ARMG-274ARMG274armg00274
    • 2016-10-06
    397 min

    [SW-439]Schoolgirl Cousins Learned The Art Of Panty Shot Temptation When I Met My Cousins For The First Time In Years, They Had Grown Up Into Cute Gal Types And They Were Trying To Tempt Me With Their Juicy Looking Asses If I Don't Dig In, I May

  • censoredschoolgirlSWswitchraito fuji makotoSW-439SW4391sw00439
    • 2016-09-22
    198 min

    [SW-436]A Schoolgirl Who's Gotten Wet From Sweat Or The Rain In A See Through Bra And Panty Shot Will Guarantee The Strongest And Hardest Hard On We Found Ourselves A Schoolgirl With A See Through Bra And Panty Shot But After Staring At Her For T

  • censoredschoolgirlSWswitchraito fuji makotoSW-436SW4361sw00436
    • 2016-09-09
    124 min

    [RTP-079]I See A Girl Who Does To The Same School On The Way Home Nodding Off And Falling Fast Asleep... Seeing Her Cute Sleeping Face, Suddenly My Legs Don't Work! Her Legs Open More And More To Show Her Panties... 3

  • nao koike azuki ogura censoredschoolgirlRTPprestigerealdocument plusRTP-079RTP079118rtp00079