javcensored female college student sister censored




FC2DASDAUKGSSNINACRNGODAUKGMIAAVENUPPPDMVSDNACXGVHAVSACHRVSQTEMARAATIDGMEMSHKDFSDSS

2024-03-20
128 min

DANDY-907 Upble The Beautiful Esthetic Sister Who Was Refused The Back Op At The End Of Work!A Squirting Bian Female College Student That Sticks Until The Lesbian Falls

  • censoredsquirtingDANDYdandyfujiwara mariaDANDY-907DANDY9071dandy00907
    • 2024-02-16
    120 min

    MIAB-110 Every Day, I Peeked At My Older Brother Who Was Being Taught Kissing By A Female College Student Tutor And Was Steadily Improving...I (my Younger Sister) Also Started Kissing...Hikaru Minazuki

  • hikaru minazuki ayame miyakozaki censoredschoolgirlbeautiful girlMIABmoody ssapporo taroeveryone s kikatanMIAB-110MIAB110miab00110
    • 2023-10-21
    49 min

    GESY-018 An Extremely Likeable Female College Student Whose Breasts Are Punk But Her Dreams For The Future Are A Bit Modest [Consciousness Clouded]

  • amateur censoredcreampiebig titsgesygesy-018gesy018gesy-018
    • 2023-10-19
    147 min

    UZU-004 Time Stops, A World Where Time Stops, The Night The Birthday Sisters Fall Into Silent Sex That They Have Never Experienced Before.

  • miyoka satomi suzune anka censoredsisterUZUmarukaa suzumaki sasakimarcanoUZU-004UZU004h-1716uzu00004
    • 2023-07-14
    160 min

    HMN-420 Rookie 1 Second Before I Cum Immediately! So Sensitive! G Cup God Kubire Active Female College Student Creampie AV Debut! ! Makina Senzoku

  • senzoku makina censoredcreampiesingle workHMNbookmichiru arashiyamaHMN-420HMN420hmn00420
    • 2023-07-07
    150 min

    HUNTB-597 Gaming Harem Live-action Version

  • satsuki mei sarina momonaga censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-597HUNTB597huntb00597
    • 2023-06-30
    260 min

    DVDMS-972 General Men"s And Women"s Monitoring AV In A Special Magic Mirror Room, A Lovey-dovey College Student Couple Breaks Up Into Men And Women And Challenges The Amazing Endurance Of AV Actresses And Actors! ! Cute Erotic Ass Older Siste

  • mizuki yayoi censoredcreampieamateurDVDMSdeepsfunky haseideep sDVDMS-972DVDMS972dvdms00972
    • 2023-06-19
    56 min

    NHDTB-80004 Restraint Slow Piston Rape 4 A Woman Who Was Raped By A Brutal Old Man Who Enjoys The Reactions Until She Slowly Inserts A Raw Cock And Cums Inside Out A Fair-Skinned Female College Student

  • censoredcreampieNHDTBnatural highraftin maeshironatufileNHDTB-80004NHDTB800041nhdtb80004
    • 2023-05-19
    210 min

    HUNTB-480 "There"s A Reason Why I"m Satisfying My Sister"s Libido." Finally I Can"t Tell My Parents "I Can Just Insert A Little Bit"

  • censoredcreampieHUNTBhunterkonjac kanohhh groupHUNTB-480HUNTB480huntb00480
    • 2023-04-21
    178 min

    AKIB-017 Reprinted Thanksgiving Price 1980 Yen Female College Student Only After Drinking Party, Take It Back To The Room, Voyeur And Silently Go To AV No.37 Sexy Older Sister JD Creampie Kumi / J Cup / 21 Years Old (Tall 170cm, Sexy Older Sister Pie

  • amateur censoredslutAKIBone night stand mature woman gammadionAKIB-017AKIB017akib00017
    • 2023-03-24
    180 min

    AKIB-016 Reprint Thank-You Price 1980 Yen, Limited To Female College Students, After A Drinking Party, Take It To Your Room, Voyeurism, Then Shut Up To Av No. 29 Slutty Brown Haired Jd Older Sister Edition Nana/G Cup/21 Years Old Saki/H Cup/21 Years

  • censoredslutAKIBomochikaeri mousozokugroupAKIB-016AKIB016akib00016
    • 2023-03-06
    115 min

    083PPP-2663 Daddy Activity Highlights-Erotic Ass OL 25 Years Old & Sensitive H Cup Nursery Teacher 21 Years Old & Young-faced Bimbo Female College Student 22 Years Old

  • amateur censoredbig titsamateurpppppp-2663ppp2663083ppp-2663
    • 2023-02-28
    121 min

    STARS-788 “Your Pussy Will Be Worse Than Your Older Sister'S, Right?” My Girlfriend'S Younger Sister, Who I Hadn'T Dealt With Because She Was Too Young, Became A Slutty Female College Girl And Seduced Me! Intense Sex Till Morning Even Though Her Girl

  • nishimoto meisa censoredsistersingle workSTARSsod createoosaki hirokoujisod starSTARS-788STARS7881stars00788
    • 2023-02-24
    220 min

    AKIB-015 Reprint Thank-You Price 1980 Yen, Limited To Female College Students, After A Drinking Party, Take It To Your Room, Voyeurism, Then Shut Up To Av No.28 Slutty Jd Older Sister Edition Mana/I Cup/21 Years Old/H Cup/21 Years Old

  • censoredamateurAKIBomochikaeri mousozokugroupAKIB-015AKIB015akib00015
    • 2023-01-26
    117 min

    FSDSS-534 A Record Of A Sober, Big-Breasted Female College Student 'Growing' To An Unmistakably Busty Older Sister With A Sexual Desire That Surpassed Her Virgin Boyfriend. Hongo Ai

  • ai hongo nikaido yume censoredFSDSSfalenodazai chinpofaleno starFSDSS-534FSDSS5341fsdss00534
    • 2022-11-24
    197 min

    VOV-094 The Greatest Big Gathering! Rosary Tsunagi Orgy Sex Party Vol.29 “Can You Introduce Me To A Hornier Friend Than Your Sister?”

  • censoredcreampiecosplayVOVit 039 s thursday everyone gatherorgy from thursdayVOV-094VOV094h-1350vov00094
    • 2022-11-11
    240 min

    DVDMS-887 General Gender Monitoring Av Female College Student'S Sister And Brother Challenge Their Exciting 24-Hour Roulette Life! The Relationship Between The Siblings Who Carried Out The Extreme Erotic Mission That Hit The Mark After 2 Times Sudden

  • censoredDVDMSdeepspoolsidedeep sDVDMS-887DVDMS887dvdms00887
    • 2022-09-23
    130 min

    HUNBL-109 Aphrodisiac Pickled At An Orgy Party I Was Tricked Into Attending! My Older Sister, Who Was Homely And Serious, Has Changed Her Appearance... I'M Supposed To Rescue My Sister, But I'M Forced To Have Incest With My Sister...

  • censoredcreampieHUNBLhuntermikkoro chanhhh groupHUNBL-109HUNBL109hunbl00109
    • 2022-05-30
    73 min

    EROFV-055 Amateur College Girl (Exclusively) Aspiring Female Anchor. Beautiful Woman (Age 21) Miku, Neat And Clean Older Step-sister! Loves Trains, Smart, Pure And Intelligent Girl To Enjoy To The Fullest! Working Hard To Make Sure This Beautiful God

  • censoredcreampieEROFVhamedori.network secondeditionlove girlfriendEROFV-055EROFV055h-1472erofv00055
    • 2022-04-07
    106 min

    GS-430 Inevitable Escape With My Three Little Sister-In-Laws Who Have Big Tits And Are Tempting Sluts! A Life Of Having Sex Over And Over In An Antlion Pit!

  • censoredcreampieschoolgirlGSsosoru x garconoukisosoru garconGS-430GS4301gs00430
    • 2022-02-11
    240 min

    [DVDMS-776]A Normal Boys And Girls Focus Group Adult Video A College Girl And Her Little Stepbrother Are On A Rotating Bed And Playing The 24-Hour Roulette Life Challenge! In A Showa-Era Love Hotel Spin The Wheel And Whatever Excessive Erotic Mission

  • censoredcreampieamateurDVDMSdeepDVDMS-776DVDMS776dvdms00776
    • 2021-11-05
    160 min

    [DVDMS-735]A Normal Boys And Girls Focus Group Adult Video These Stepbrothers And Sisters Are Keeping It In The Family And We Followed Up To See What Was Going On In This Special A Kind And Gentle Big Tits Stepsister And Her Cherry Boy Little Stepbro

  • censoredcreampiebig titsDVDMSdeepssatou tamaoDVDMS-735DVDMS735dvdms00735
    • 2021-07-08
    157 min

    [SW-786]My Buddy's Little Sister Came Home From Her First Year Of University In Tokyo Wearing A Tiny T-Back That Parts Her Sweet, Thick Ass Cheeks. I've Never Been This Hard In All My Life! This City College Slut Is A Whole New Woman!!

  • censoredsisterSWswitchraito fuji makotoswitch hibinoSW-786SW7861sw00786
    • 2021-06-10
    179 min

    [NHDTB-540]We Hate Our Gross Step Father, But... Big Titty Step Sisters Are Given Aphrodisiacs And Become So Horny They Fight Over Their Step Father's Dick And Fuck Him At The Same Time

  • censoredbig titssisterNHDTBnatural highkansukeNHDTB-540NHDTB5401nhdtb00540
    • 2021-05-14
    170 min

    [PPPD-924]A Girl Living In Saitama! This Little H-cup College Girl With Huge Tits Is Having Her AV Debut: Rion Hirano

  • rion hirano censoredbig titssingle workPPPDoppaiPPPD-924PPPD924pppd00924
    • 2021-04-23
    147 min

    [JUFE-284]She Really Wants To Be Spoiled, But Your Sensitive Busty Stepsister Is Too Shy To Ask - Sweet Dirty Talk Seduction Mei Satsuki

  • satsuki mei censoredbig titssisterJUFEfitchJUFE-284JUFE284jufe00284
    • 2021-03-05
    241 min

    [HEZ-260]Sex Play With Friends! 3 Girls Do Embarrassing Sex Stuff In Front Of Their Friends! 18 Girls

  • censoredamateurHEZhot entertainmenthotHEZ-260HEZ26059hez00260
    • 2021-01-16
    122 min

    [MXGS-1166]Stepbrothers Can't Get Enough Of Their Adorable New Stepsister Natsu Tojo

  • natsu tojo censoredbeautiful girlsisterMXGSmaxingMXGS-1166MXGS1166h-068mxgs01166
    • 2021-01-08
    241 min

    [HEZ-243]Guaranteed Satisfaction! We Seduced An Amateur Girl And Seriously Sweet-Talked Her! Best Edition 14 Girls

  • censoredbig titsamateurHEZhot entertainmentnetsuyujinHEZ-243HEZ24359hez00243
    • 2020-12-11
    255 min

    [SKMJ-135]"Will You Punch My V-Card？" We Send Male Virgins To The Houses Of Real Amateur College Girls! You Can See Their Panties Get Wet In Real Time At The Thought Of Breaking These TrouB**d Guys In! Watch As They Cum Hard And Cum Again To

  • censoredbeautiful girlSKMJred face girlxyzSKMJ-135SKMJ135h-1324skmj00135
    • 2020-10-16
    112 min

    [MXGS-1155]Erina Oka Is Like An Innocent Little Stepsister And I'm About To Fuck Her With Quickie Sex

  • hill erina censoredbeautiful girlsisterMXGSmaxingkeiha nobuyoMXGS-1155MXGS1155h-068mxgs01155
    • 2020-10-02
    241 min

    [HEZ-211]The Shame Of Two Sisters 2 These 16 Amateur Girls Are Bashfully Getting Busy When It's A Big Sister And Little Sister Getting It On Together This Is The Ultimate Male Romantic Dream! Go For The Double Blowjob Dream Cum True!

  • censoredamateurHEZhot entertainmentHEZ-211HEZ21159hez00211
    • 2020-09-27
    120 min

    [AUKG-496]Best Friends The Lesbian Series - They Love Each Other, But Pretend To Hate Each Other - Aoi Tojo Kotona Hirakawa

  • tojo hirakawa kotona censoredlesbiandramaAUKGu krentoAUKG-496AUKG496aukg00496
    • 2020-09-18
    81 min

    [FTBL-004]Will It Drive People Insane!？ The Ultimate Love Pillow! Has A Comfortable Fit And Grip You Might Not Let Go Of Once You Try？ The Round Soft Marshmallow Body Can Be Easily Squeezed Tight! Great Character! Never Cheated Before, This National

  • censoredbeautiful girlFTBLfalenodavielfalenotubeFTBL-004FTBL0041ftbl00004
    • 2020-09-16
    88 min

    [MXGS-1150]The College Girl Next Door Seems Shy But She Gets Wild In The Bedroom - Sweet, Sexy, Cute Kaede Ito

  • kaede ito censoredbeautiful girlsingle workMXGSmaxingkeiha nobuyoMXGS-1150MXGS1150h-068mxgs01150
    • 2020-09-12
    152 min

    [MIFD-130]Nice And Quiet. A New Face Debut A S*****t In The English Department At A Super Famous Private University An Exquisite Exchange S*****t College Girl Yukino Nagasawa

  • yukino nagasawa censoredblowjobsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-130MIFD130mifd00130
    • 2020-08-08
    152 min

    [MIFD-128]170cm Tall This Girl Has Long Arms And Legs, Just Like A Super Model A Real-Life Elegant College Girl Fresh Face A Handsome Beauty She's Making Her Divine Blowjob Debut!! Reina Kinjo

  • reina kaneshiro censoredblowjobsingle workMIFDmoodyzarashiyama michirumoodyz freshMIFD-128MIFD128mifd00128
    • 2020-07-11
    35 min

    [HHKL-047]I Could See My Little Stepsister's Ass Bulging Out Of Her Knitted One Piece Dress And Her Knee-High Socks, And It Looked So Sexy That I Had To Fuck Her, And So I Creampie Fucked Her Over And Over Again, And As A Result...!？

  • censoredcreampiesisterHHKLhuntercognac kaminohhh groupHHKL-047HHKL047hhkl00047
    • 2020-07-10
    247 min

    [SKMJ-110]"Lately, I've Been Thinking About You, A Lot..." This Horny Little Stepbrother Has Been Seeing His Divinely Beautiful Big Stepsister As A Woman, And So We Bring You This Helpful Variety Special To Solve All Of Those Problems! We

  • censoredcreampieamateurSKMJred face girlxyzSKMJ-110SKMJ110h-1324skmj00110
    • 2020-07-03
    122 min

    [EQ-521]Let Me Help You Jack Off! Cute Girls Grip Your Dick And Help You Ejaculate 9

  • censoredbig titsamateurEQbullittshinobu kamezufetish specialtyEQ-521EQ521h-100eq00521
    • 2020-06-06
    175 min

    [HUNTA-785]My Little Stepsister Was Wearing A Knitted One Piece Dress And Knee-High Socks, And Thrusting Out Her Ass, And I Could No Longer Resist, So I Plunged My Cock Into Her And After Creampie Fucking Her, Over And Over...!？ 2 Once She Became A C

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-785HUNTA785hunta00785
    • 2020-05-28
    241 min

    [HEZ-177]Real Fuck In Front Of Friends!! That's What Makes A Woman Most Embarrassed! Fucking In Front Of Her Friends! They Still Do It Though!! 18 Girls

  • censoredamateurHEZhot entertainmentHEZ-177HEZ17759hez00177
    • 2020-05-28
    185 min

    [EQ-519]We're Taking Home A College Girl For Some Serious Sex! We're Pumping Her Raw Until She Cries With Anal Pleasure! #03

  • censoredbig titsEQbullittkuroto masatoimpulseEQ-519EQ519h-100eq00519
    • 2020-05-16
    115 min

    [ROYD-006]Usually My Little Stepsister Is A Cute Plain Jane With A Big Ass, But Then She Started Showing Off The Total Domain Of Her Pussy, And By The Time I Realized What Was Happening, I Had Creampie Fucked her. Akari Neo

  • akari neo censoredcreampiebeautiful girlROYDroyalcognac kaminohhh groupROYD-006ROYD006royd00006
    • 2020-04-28
    241 min

    [HEZ-170]Sisterly Shame You Get To Engage In A Bashful Yet Sensual Situation Involving A Big Sister And Her Little Sister 16 Amateur Girls This Is What All Men Dream About! Go For That Double Blowjob

  • censoredamateurHEZhot entertainmentHEZ-170HEZ17059hez00170
    • 2020-04-28
    164 min

    [EQ-515]Will You Squeeze My Big Tits？ Picking Up Local Amateurs With Big Tits!

  • censoredcreampiebig titsEQbullittrocket taropretty honey brittEQ-515EQ515h-100eq00515
    • 2020-03-14
    240 min

    [DVDMS-518]A Normal Boys And Girls Focus Group Adult Video College S*****t Babes Only A Thrilling Sleepover Mission That Will Test The Bonds Of Stepbrother And Stepsisterhood! If This College Girl Big Stepsister Spends The Night With Her Little Stepb

  • censoredcreampieamateurDVDMSdeep sDVDMS-518DVDMS518dvdms00518
    • 2020-03-06
    169 min

    [EQ-507]Secret Hot Pranks Inside The Futon "Hey!？ My Boyfriend Is Going To Catch Us If We Keep Doing This!" She Got Fucked By Her Boyfriend's Friend And Now She's Enjoying Serious Raw Sex! 3

  • censoredcreampiebig titsEQbullittbalcony fuckingerotic touchingEQ-507EQ507h-100eq00507
    • 2020-03-06
    126 min

    [EQ-506]Let Me Help You Jack Off! Cute Girls Grip Your Dick And Help You Ejaculate 8

  • censoredbig titsamateurEQbullittshinobu kamezufetish specialtyEQ-506EQ506h-100eq00506
    • 2020-02-16
    116 min

    [MXGS-1131]She Gets Bullied By Her Stepdad Who She Hates, But The Sex Is Surprisingly Good! - Nozomi Arimura

  • arimura nozomi censoredblowjobbeautiful girlMXGSmaxingno directorMXGS-1131MXGS1131h-068mxgs01131
    • 2020-02-07
    300 min

    [HEZ-136]Picking Up Amateur Girls - 11 Specially Selected Cute Girls!

  • censoredcreampiebig titsHEZhot entertainmentnetsuyujinHEZ-136HEZ13659hez00136
    • 2020-02-01
    119 min

    [JUL-132]"Hey Big Stepbrother, You Can Fuck Me If You Want" My Wife's Young Sister Looks Like A Plain Jane Big Tits Girl, But In Reality She's A Secretly Horny Bitch, And She Pulled Some Reverse Cuckold Fucking On Me During Our Vacati

  • ena koume censoredbig titssisterJULmadonnajyoji kawaiJUL-132JUL132jul00132
    • 2020-01-10
    165 min

    [EQ-500]SNSで見つけた本物シロウト エロい巨乳に生素股のお願い！相手が田舎娘だから思いっきり悪事してます！vol.01

  • censoredbig titsamateurEQbrittmissile taropretty honeyEQ-500EQ500h-100eq00500
    • 2019-12-10
    123 min

    [EQ-492]Secret Hot Pranks Inside The Futon "Hey!？ My Boyfriend Is Going To Catch Us If We Keep Doing This!" She Got Fucked By Her Boyfriend's Friend And Now She's Enjoying Serious Raw Sex! 2

  • censoredcreampiebig titsEQbullittshuzo kuriyamaitazuraEQ-492EQ492h-100eq00492
    • 2019-12-07
    211 min

    [HJMO-420]The 7th Best Little Sister Grand-Prix No Panties Allowed, If You Get A Sweat Stain, You Lose The Big Vibrator Endurance Battle

  • censoredsquirtingHJMOhajime kikakuHJMO-420HJMO420hjmo00420
    • 2019-11-20
    136 min

    [GVG-967]Ass-Loving Shota-kun's Lewd Prank Tsubasa Hachino

  • yano tsubasa censoredsingle workGVGglory questyumeno aidaGVG-967GVG96713gvg00967
    • 2019-11-02
    196 min

    [HUNTA-675]My Stepsister's Ass Is Sticking Out Between Her Knitted Dress And Her Knee-High Socks, And I Just Can't Keep My Hands Off Her! I Fuck Her And Creampie Her Again And Again!

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-675HUNTA675hunta00675
    • 2019-11-02
    306 min

    [HUNTA-678]"No Way! What Are You Doing？! If You Move So Fast, I'm Going To Cum Too Soon!" - Sister-In-Laws Grind Their Hips Riding Cowgirl Style On Their Brother-In-Laws' Cocks!

  • censoredcreampiesisterHUNTAhuntervolvo nakanohhh groupHUNTA-678HUNTA678hunta00678
    • 2019-10-25
    248 min

    [MDTM-571]Hikaru Minazuki Best Hits Collection 4 Hours

  • hikaru minazuki censoredcreampieschoolgirlMDTMmedia stationuchu kikakuMDTM-571MDTM57161mdtm00571
    • 2019-10-25
    149 min

    [SABA-570]He'll Manage You Career And His Recommendation Is His Word, And Every Lady He Picks Is A Winner!

  • censoredamateurSABAskyu shirotoSABA-570SABA570h-244saba00570