pov censored javcensored beautiful breasts




FC2APODAUKGCJODSANJULWANZSSNIMIAASQTECAWDMVSDHMNCHRVMIDENNPJSTARSFSDSSGVHCESDKBI

2024-04-07
118 min

300MIUM-1064 [I Like Continuity] Rental Of F -cup Beautiful Breasts As Her!Completely REC Of The Whole Story, Which Has Been Deducted And Spoiled To Erotic Acts That Are Originally Prohibited!!When A Kimono Looks Good, The Gap That Asks For Verokis W

  • amateur censoredcreampiebig titsmiummium-1064mium1064300mium-1064
    • 2024-04-06
    325 min

    HOIZ-120 Hoi Hoi HOME Uchi Ochi 18 Amateur Hoi Hoi SH ・ Personal Shooting, One Night / Matching App, Home, Amateur, Beautiful Girl, Sister, Student, Gonzo, Gonzo, Breasts, Breasts, Breasts, Big Breasts, Big Butt, Squirting, Squirting, Constriction・ D

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-120HOIZ120hoiz00120
    • 2024-04-04
    67 min

    420STH-067 Mahilu (23) [Amateur Hoi Hoi Stayhome/At Home/Amateur/Beautiful Girl/Big Breasts/Big Breasts/Electric/Squirting/Gonzo/Gonzo/Documentary]

  • amateur censoredbig titssquirtingsthsth-067sth067420sth-067
    • 2024-03-31
    72 min

    MAAN-967 [Burning Thick Thick Big Butt] Nipple Stains Flood!Show Off Beautiful Breasts That Are Too Sensitive And Invite Erections JD And One -nai Species SEX!The Plump BODY, Which Is Intimidated, Is The Supreme Holding Comfort ♪ Creampie & Facial Cu

  • amateur censoredcreampieamateurmaanmaan-967maan967maan-967
    • 2024-03-30
    94 min

    326FCT-095 G Cup Beauty Who Likes Alcohol And SEX Beats From The Backspone Area!Raw Vaginal Cum Shot In A Fleshy Plump Muchimi Super Erotic Body!!

  • rina censoredcreampieuniformfctfct-095fct095326fct-095
    • 2024-03-23
    320 min

    HOIZ-118 Hoi Hoi HOME Uchi Uchi 17 Amateur Hoi Hoi SH ・ One Knight / Matching App, Home, Amateur, Beautiful Girl, Married Woman, Housewife, Sister, Gonzo, Gonzo, Breasts, Breasts, Big Breasts, Fair, Squirting・ Denma / Documentary ・ Slut ・ Neat / Faci

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-118HOIZ118hoiz00118
    • 2024-03-22
    98 min

    HMRK-004 [Marunouchi Huge Breasts OL] Gonzo SEX With A Super Glamorous God Body Beauty!!Jubujubo Blowjob That Looks Delicious To The Back Of The Throat!At The Mercy Of A Man With A Fucking And Buttocks That Make You Invisible!Rich Beautiful Breasts A

  • amateur censoredcreampiebig titshmrkhmrk-004hmrk004hmrk-004
    • 2024-03-21
    90 min

    KAMEF-074 Individual Photography Specialized Huge Breasts Cosplay Photo Session And Achan (24) Machida Lens Black Kameko File.74 J Cup Nun Offica Rayer

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-074KAMEF074h-1350kamef00074
    • 2024-03-15
    240 min

    360MBM-811 Advent!Miracle Breasts -chan Big Breasts Manate Kyun (Heart) Milk Covered 12 People 4 Hours SP 4

  • amateur censoredbig titsamateurmbmmbm-811mbm811360mbm-811
    • 2024-03-14
    93 min

    354KAMEF-073 Individual Specialization Cosmetic Photo Session Akari Nyan (21) BLACK KAMEKO FILE.73 Outside Store Connected Concafe Miss The First Raw SEX Experience For The First Time That You Can Not Tell To Anyone.

  • amateur censoredcreampieamateurkamefkamef-073kamef073354kamef-073
    • 2024-03-14
    97 min

    420STH-062 SUMILE (20) [Amateur Hoi Hoi Stayhome/Bring In Home/Amateur/Beautiful Girl/Big Breasts/Breasts/Squirting/Gonzo/Documentary]

  • amateur censoredbig titssquirtingsthsth-062sth062420sth-062
    • 2024-03-13
    93 min

    mfc-284 Shin P (24)

  • amateur censoredcreampiesquirtingmfcmfc-284mfc284mfc-284
    • 2024-03-12
    88 min

    326FCT-094 Slender Body And Gachi Beauty Big Breasts F -cup Back Dirt JD To Be Cosplayed In Uniforms And Creampie Gonzo

  • yuzu censoredcreampiebig titsfctfct-094fct094326fct-094
    • 2024-02-27
    140 min

    298HONB-359 Gari Suta Gram # 001

  • amateur censoredcreampieamateurhonbhonb-359honb359298honb-359
    • 2024-03-08
    91 min

    420HHL-064 N.H (20) Amateur Hoi Hover, Amateur, Couple Gonzo, Part -time Job, Big Breasts, Squirting, Cosplay

  • amateur censoredbig titssquirtinghhlhhl-064hhl064420hhl-064
    • 2024-03-07
    75 min

    420STH-060 AYASE (22) [Amateur Hoi Hoi Stayhome/Bring In Home/Amateur/Beautiful Girl/Big Breasts/Breasts/Breasts/Breasts/Gonzo/Documentary]

  • amateur censoredbig titsamateursthsth-060sth060420sth-060
    • 2024-02-27
    52 min

    298HONB-358 Steep Sloping Beautiful Girl Boyfriend And Cheating Gonzo.

  • amateur censoredamateurbeautiful girlhonbhonb-358honb358298honb-358
    • 2024-02-17
    106 min

    SQTE-524 A Beautiful Girl Who Wants To Do Her Best! G Cup Big Breasts Heal Your Mind And Body And Have Sex Mei Itsukaichi

  • itsukaichi mei censoredbig titsblowjobSQTEs cuteSQTE-524SQTE524sqte00524
    • 2024-02-16
    160 min

    EBWH-068 Alice Nanase"s Overwhelming Face And Slim Beautiful Big Breasts Are Specialized In W. Demonic Masturbation Support That Will Make Your Penis Look Foolish.

  • alice nanase censoredEBWHe bodyzampaEBWH-068EBWH068ebwh00068
    • 2024-02-15
    84 min

    simm-873 Nana(18)

  • amateur censoredcreampieuniformsimmsimm-873simm873simm-873
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-14
    60 min

    DOCS-006 [Big Breasts Shot] A Pervert With An Outrageous Breast Bag Appears! I Came To Have Sex With A G Cup Female College Student Who Is A Nice Buddy That Both Myself And Others Recognize! [Clothed Big Breasts]

  • here censoredbig titsamateurdocsdocs-006docs006docs-006
    • 2024-02-11
    45 min

    DDHP-048 Cheating Sex With A Chinese Maid Con Cafe Girl! Creampie Into A Female Brat With A Small And Beautiful Ass! [Sana (20)]

  • sana censoredcreampieamateurddhpddhp-048ddhp048ddhp-048
    • 2024-02-01
    71 min

    324SRTD-0388 She Is Slender And Has A Beautiful Body With Big Breasts.

  • amateur censoredbig titsamateursrtdsrtd-0388srtd0388324srtd-0388
    • 2024-02-01
    88 min

    KAMEF-067 Specializing In Individual Photography Big Breasts Cosplay Photo Session Ayako Machida Lens"s BLACK KAMEKO FILE.67 Real Hollywood Star And Returned Home Video Leaked Lewd Erotic Breasts Swaying And Trembling Ayako"s First Cosplay St

  • censoredcreampieamateurKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-067KAMEF067h-1350kamef00067
    • 2024-01-31
    68 min

    MFC-278 Extremely Soft Plump Body X Natural H Cup Big Breasts [Nana (OL)] Really Big Boobs Are Alluring/She"s So Obedient That She"s Totally Clingy To Her Boyfriend/Go To The Love Hotel Instead Of The After-party! ! /Super Breasts//Milk Pushe

  • seven censoredcreampiebig titsmfcmfc-278mfc278mfc-278
    • 2024-01-29
    89 min

    476MLA-163 [Only Teenagers Can Win! ] Beautiful Big Breasts F Cup And Fair Skin Slender Super Divine Body! ! At School, I Creampied A Serious And Clean J

  • ahtan censoredcreampiebig titsmlamla-163mla163476mla-163
    • 2024-01-29
    261 min

    MAZFX-007 007 [Many Masochists In The School: All Addicted To Dick] Slender Active Track And Field Team, Beautiful Breasts And Nice Butt Japanese Language Teacher, Instant Masochistic Young Lady, Piggyback And Pussy-haired Math Teacher, All Trained F

  • censoredcreampieMAZFXbeatleMAZFX-007MAZFX007h-1719mazfx00007
    • 2024-01-28
    89 min

    476MLA-162 H Cup Overwhelming Voluptuous BODY! ! It"s The Best Thing To Have A Big-breasted Plain Girl Who Is Serious At Work Play A Naughty Cosplay And Cum Inside Her Instinctively Lol

  • merutan censoredcreampiebig titsmlamla-162mla162476mla-162
    • 2024-01-27
    84 min

    326RCH-002 My Best Friend, Who I Had A Crush On For A Long Time, Found A Lover.

  • chiharu censoredcreampieamateurrchrch-002rch002326rch-002
    • 2024-01-26
    80 min

    KAMEF-066 Specializing In Individual Photography Big Breasts Cosplay Photo Session Mikurun Machida Lens"s BLACK KAMEKO FILE.66 J Cup Big Breasts Divine Breasts Cosplayer Shooting Pink Areolas Swaying Sideways In Side Breasts Cosplay Titty Fuck Er

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-066KAMEF066h-1350kamef00066
    • 2024-01-25
    103 min

    420HHL-063 H.K(23) Amateur Hoi Hoi Lover, Amateur, Couple POV, Temporary Employee, Beautiful Breasts, Squirting, Cosplay, Dancer

  • amateur censoredsquirtingamateurhhlhhl-063hhl063420hhl-063
    • 2024-01-23
    99 min

    MFCS-101 [Highly Educated Beauty With Super Beautiful Breasts! A SEX Specialized Body Whose Breasts And Buttocks Bounce With Every Piston! ] The Person I Fell In Love With Is An Older Married Man! ？ I Want To Be Close To A Woman Who Is Convenient For

  • sayla censoredcreampieamateurmfcsmfcs-101mfcs101mfcs-101
    • 2024-01-21
    101 min

    300MIUM-1005 [3D Beautiful Big Breasts] Rent An Active Art College Student With Anime Voice And F Cup Beautiful Big Breasts As Your Girlfriend! A Complete Record Of The Entire Story Of How He Seduced Her And Even Performed Erotic Acts That Were Origi

  • amateur censoredcreampiebig titsmiummium-1005mium1005300mium-1005
    • 2024-01-20
    68 min

    SIRO-5203 [Beautiful Big Breasts Titty Fuck] [Little Devil-chan] A Beautiful Girl With A Half-faced Face And Natural Bruises And 100 Cuteness! ! Her Loving Smile Turned Into An Expression That Looked Like She Was About To Cry Due To The Pleasure She

  • amateur censoredbig titsamateursirosiro-5203siro5203siro-5203
    • 2024-01-14
    47 min

    DDHP-046 Two Creampies To A 93cm Big Breasts & 93cm Big Butt Con Cafe Girl! Infinite Piston On A Chinese Maid With A Sexy Body! [Kayaro (26)]

  • koyo censoredcreampiebig titsddhpddhp-046ddhp046ddhp-046
    • 2024-01-13
    320 min

    HOIZ-111 Hoi Hoi Punch 33rd Amateur Hoi Hoi Z, Personal Shooting, One Night, Matching App, Love Hotel, Amateur, Beautiful Girl, Gonzo, Big Breasts, Beautiful Breasts, Facial, Electric Massager, Waist, Tall, Squirting, Documentary

  • censoredamateurHOIZamateur hoihoi delusion groupHOIZ-111HOIZ111hoiz00111
    • 2024-01-10
    96 min

    420STH-056 HIMALI (20) [Amateur Hoi Hoi Stay Home/Bring Home/Amateur/Beautiful Girl/Big Breasts/Beautiful Breasts/Neck/Squirting/Gonzo/Personal Shooting/Documentary]

  • amateur censoredbig titssquirtingsthsth-056sth056420sth-056
    • 2024-01-03
    94 min

    MFC-274 Beautiful Latest Reiwa Girl X Beautiful Big Breasts Otsu π Advent [Moka (Apparel Clerk)] Why Are You Taking Pictures？ ♪(I Love Gonzo)/The Physical Relationship Is Better This Way...♪/Double Cheating Date/Rich Creampie Even Though My Boyfriend

  • amateur censoredcreampiebig titsmfcmfc-274mfc274mfc-274
    • 2024-01-03
    52 min

    INSTV-521 [Big Breasts Icup Beautiful Girl] Perfect Breasts 102cm! Female College Student Hana-chan (21) Raw Creampie Personal Video Of An Amateur Couple Who Are Particular About The Strongest Breasts

  • censoredbig titsamateurINSTVhmn worksinstaINSTV-521INSTV521h-1472instv00521
    • 2023-12-30
    130 min

    PKGP-007 Sweetheart Love Document - Natural Hairy Big Breasts Erotic Final Form One Day Flirty Date With Amaharuno Ai

  • ai tenharu censoredcreampiesingle workPKGPpakopako team and pleasant friends delusion groupPKGP-007PKGP007pkgp00007
    • 2023-12-28
    68 min

    420HPT-005 Mito (21) Amateur Hoi Hoi, Amateur Hoi Hoi Pet, Amateur, Beautiful Girl, Sex Friend, Big Breasts, Slender, Outdoors, Exposure, Shame, Toys, Gonzo

  • amateur censoredbig titsamateurhpthpt-005hpt005420hpt-005
    • 2023-12-22
    73 min

    326PAPA-039 [Too Sensitive And Infinite Climax] Beautiful Big Breasts F Cup! 19 Year Old Baby-faced Loli Beautiful Girl! After Repeated Negotiations With A Cash-strapped VT●b●r Who Can"t Sell, He Has Raw Sex And Creampie! ! [Dad Activity Infiltra

  • amateur censoredcreampiebig titspapapapa-039papa039326papa-039
    • 2023-12-21
    85 min

    420HOI-258 きさき(20) 素人ホイホイZ・素人・ドキュメンタリー・ハメ撮り・貧乳・微乳・清楚・黒髪・美少女

  • amateur censoredamateurbeautiful girlhoihoi-258hoi258420hoi-258
    • 2023-12-16
    94 min

    420SEF-012 Hitomin(27) Amateur Hoi Hoi, Amateur, Gonzo, Documentary, Older Sister, Big Breasts, Cosplay, Beautiful Butt, Personal Shooting

  • amateur censoredbig titsamateursefsef-012sef012420sef-012
    • 2023-12-20
    89 min

    326FCT-081 In The Multipurpose Toilet And Senior"s Room! ! Couple POV Of J●, A Beautiful Girl From The Slope Who Belongs To The Brass Band, Loses Her Virginity

  • amateur censoredcreampieamateurfctfct-081fct081326fct-081
    • 2023-12-15
    84 min

    420STH-054 WAKU(24) [Amateur Hoi Hoi Stay Home/Bring Home/Amateur/Beautiful Girl/Gal/Big Breasts/Neck/Beautiful Butt/Fair Skin/Electric Massager/Squirting/Gonzo/Personal Shooting/Documentary]

  • amateur censoredbig titssquirtingsthsth-054sth054420sth-054
    • 2023-12-14
    77 min

    420ERK-038 Usapyon (21) Amateur Hoi Hoi, Erotic Kyun, Amateur, Beautiful Girl, Slender, Waist, Big Breasts, Beautiful Breasts, Nurse, Cosplay, Gonzo

  • amateur censoredbig titsamateurerkerk-038erk038420erk-038
    • 2023-12-13
    110 min

    420HHL-056 R.B(20) Amateur Hoi Hoi Lover, Amateur, Couple Gonzo, Cosplay, Part-time Job At A Family Restaurant, Maid, Beautiful Breasts, Round 2

  • amateur censoredamateurcosplayhhlhhl-056hhl056420hhl-056
    • 2023-12-13
    67 min

    200GANA-2974 Seriously Soft, First Shot. 2002 [Black Hair X Big Breasts X Beauty] A Beautiful Woman Who Releases Enough Love Juice To Stain Her Pants Just By Kissing Her. She Is A Beautiful Woman Who Gradually Makes Loud Moans When Inserted. The Beau

  • amateur censoredsquirtingamateurganagana-2974gana2974200gana-2974
    • 2023-12-10
    138 min

    MAZO-037 [A Woman Who Seriously Wants To Be His Mistress] Provocation With Her Beautiful Face, Beautiful Breasts, And Beautiful Butt! - NTR-loving Nursery Teacher - A Slutty Meat Hole That Gets Fucked In The Uterus By Her Father"s Penis And Makes

  • censoredcreampieamateurMAZOhmn worksamateur shiba tarokanMAZO-037MAZO037h-1472mazo00037
    • 2023-12-09
    240 min

    XVSR-737 Secret Excavation Project Get Beautiful Big Breasts! Popular Actress"s Gonzo SEX SPECIAL

  • akari shinmura red fruit censoredbeautiful girlXVSRmax amax fujiicalenXVSR-737XVSR737xvsr00737
    • 2023-12-09
    103 min

    420SEF-011 MITAKE(29) Amateur Hoi Hoi, Amateur, Gonzo, Documentary, Older Sister, Tall, Big Breasts, Waist, Beautiful Ass, Beautiful Legs, Athlete, Electric Massager, Personal Shooting

  • amateur censoredbig titsamateursefsef-011sef011420sef-011
    • 2023-12-06
    59 min

    MFC-270 Beautiful Kyoto Woman With Soft And Beautiful Breasts X Curvaceous Beauty With A Curvy Neck And A Beautiful Big Butt [Hana (office Worker)] Affair Sex On A Business Trip With Her Lover/Inevitable Creampie Due To A Big Hold/Are You Still Break

  • amateur censoredcreampieamateurmfcmfc-270mfc270mfc-270
    • 2023-12-04
    58 min

    BRV-002 A Naughty Date With That Big-breasted Girl - Tokyo/Fukuoka Edition - She"s A Beautiful Girl, But She Also Has The Strongest Breasts!

  • censoredbig titssquirtingBRVbravoBRV-002BRV002h-1755brv00002
    • 2023-12-04
    115 min

    241GAREA-590 える

  • amateur censoredcreampieamateurgareagarea-590garea590241garea-590
    • 2023-12-03
    124 min

    241GAREA-589 つばさ

  • amateur censoredamateurbeautiful girlgareagarea-589garea589241garea-589
    • 2023-11-25
    320 min

    HOIZ-107 Hoi Hoi Friends 07 Amateur Hoi Hoi Friends, Amateur, Gonzo, Documentary, Personal Shooting, Big Breasts, Beautiful Breasts, Waist, Drinking, Office Lady, Masochist, Sex Friend, Squirting, Wetting, Urination, Neat, Tall, Beautiful Woman, Marr

  • censoredamateurbeautiful girlHOIZamateur hoihoi delusion groupHOIZ-107HOIZ107hoiz00107