schoolgirl jav censored javcensored panty shot




FC2WANZAPODCHRVGVHMARAWAAAMILKSHKDFSDSSMVSDSANPPPDNACRHZGDDASDROYDMIDENATRVENUEBOD

2024-04-12
82 min

OCH-018 Train Slut ● Slut Of Collective Devils ● 6

  • amateur censoredcreampieschoolgirlOCHOCH-018OCH018
    • 2024-02-09
    33 min

    OCH-281 Molestation Train #045 A Neat J● Whose Huge Breasts Are Played With

  • censoredcreampiebig titsOCHgod timescar 4OCH-281OCH281h-1580och00281
    • 2024-01-30
    36 min

    SIMD-014 Lock On A Super Miniskirt, Knee High, And Panty Shot Beautiful Girl On Her Way Home! I Touched, Smelled, Licked And Savored The Smooth And Soft Area. [Uniform/stalker/leg Fetish/thigh Job]

  • amateur censoreduniformschoolgirlsimdsimd-014simd014simd-014
    • 2024-01-20
    147 min

    MDBK-318 A Provocative Panty Shot School Of Cheeky Bimbo Gals Who Make Fun Of Teachers With Their Little Devils And Face-sitting.

  • nanaheki no aise mina censoreduniformschoolgirlMDBKbazookataro kMDBK-318MDBK318mdbk00318
    • 2023-11-11
    125 min

    TANF-009 Fainting Sex Play With R-chan, A Panty Shot School Girl I Found In The Neighborhood [Amateur Post]

  • censoredschoolgirlamateurTANFdandelion mousouzokuwowTANF-009TANF009tanf00009
    • 2023-11-01
    118 min

    TWT-039 Panty Shot Dirty Talk Provocation 4 Of Girls In Uniform Who Love Masturbation

  • censoredschoolgirlTWTsartre video publishingtwin tailsTWT-039TWT039h-897twt00039
    • 2023-09-30
    137 min

    MMUS-080 Little Devil Provocative Beautiful Girl Nana Kisaki

  • kisaki nana censoredschoolgirlMMUSmarriontakato kasaimcpMMUS-080MMUS080mmus00080
    • 2023-05-06
    96 min

    SLAP-122 Super Miniskirt School Girls Puri Ass Panty Shot 5

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-122SLAP122slap00122
    • 2023-04-15
    135 min

    SLAP-119 Today"s School Girls Who Post Panchira Videos On SNS

  • amateur censoredschoolgirlSLAPdigital arkSLAP-119SLAP119slap00119
    • 2023-04-03
    264 min

    ASGMX-003 [Handmaiden Girl Adhesive Tailing & Seeding Record] 4 School Girls, Beautiful, Clean, Skinny, Small Breasts, Hairy, Pussy-Haired Daddy, Sucking Up To The Tide, Sleep Adultery, Vaginal Cum Shot Sex Footage

  • censoredcreampieschoolgirlASGMXbeatleASGMX-003ASGMX003h-1719asgmx00003
    • 2023-03-03
    160 min

    JUNY-086 Devil'S Provocation And Unbearable Plump Panty Shot Maniax Mizuhara Misono

  • suwon miso censoredschoolgirlslutJUNYfitchnikuyokuJUNY-086JUNY086juny00086
    • 2023-02-23
    207 min

    DANDY-846 I Had A Surprise Encounter With A Slutty Girl On The Last Train! When I Got An Erection Due To The Temptation Of A Woman With Beautiful Legs Getting Double Panty Shot In The Seat Across From The Seat Across Me, I Was Fucked Over And Over Ag

  • censoredcreampieschoolgirlDANDYdandyozu kikujirouDANDY-846DANDY8461dandy00846
    • 2023-01-26
    114 min

    NHDTB-755 Cuckold Fellatio Of Little Devil J○ Who Provokes Her To Grin Twice With A Silent Panty Shot And Makes Her Ejaculate

  • censoredschoolgirlNHDTBnatural highshinmetori nakata watarukunNHDTB-755NHDTB7551nhdtb00755
    • 2022-12-22
    159 min

    SW-878 I Saw The Girls' Underpants! I Can See The Underpants Of Girls Living In The Neighborhood That I See Every Day, So When I Was Thankfully Watching Today Too, I Was Suddenly Seduced By A Panty Shot And Rushed Into A Naughty Scene.

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-878SW8781sw00878
    • 2018-03-02
    117 min

    BUHD-009 Big Vibrator Schoolgirl Babes In HD

  • miori hara yui kawagoe censoreduniformschoolgirlBUHDeitenfujieda ryuzoextracurricular activitiesBUHD-009BUHD009436buhd00009
    • 2018-02-02
    100 min

    BUHD-008 A Schoolgirl Black Tights And Dirty Talk Drama 2 HD

  • mio shiraishi mio shiraishi tsugumi muto censoreduniformschoolgirlBUHDeitenfujieda ryuzoextracurricular activitiesBUHD-008BUHD008436buhd00008
    • 2022-04-30
    140 min

    MMUS-065 Guaranteed Panty Shot Action! A Little Devil Beautiful Girl Who Will Lure You To Temptation In All Kinds Of Situations 4 Girls

  • misaki azusa mao watanabe censoredschoolgirlMMUSmarrionkasai kijinkcpMMUS-065MMUS065mmus00065
    • 2022-04-07
    224 min

    DANDY-806 This S********l Came To See Me In The Hospital And She Got Me Hard By Flashing Panty Shot Action At Me And Teased Me With A Blowjob And Made Me Cum And When My Dick Was Super Sensualized She Started Sucking On My Tip And Gave Me A Cleanup B

  • censoredschoolgirlbeautiful girlDANDYdandyDANDY-806DANDY8061dandy00806
    • 2022-04-07
    124 min

    STSK-023 A Filthy Education S*****t Peeping Panty Shot Videos Filmed By A Perverted Teacher A Filthy Breaking In Training Record

  • censoredcreampieuniformSTSKshirouto 39STSK-023STSK023h-1605stsk00023
    • 2021-12-31
    121 min

    [WAAA-134]Rural Technical School With Too Much Free Time And Panty Shot Temptation Every Day, All There Is To Do Is Rummage Around For A Big Dick! Rara Kudo

  • lara kudo censoredcreampieschoolgirlWAAAwanz factorywanzWAAA-134WAAA134waaa00134
    • 2021-12-23
    218 min

    [SW-820]Nice Panty Shot From A S********l! Catching Sight Of S********ls In Skirts Every Day When The Breeze Picks Up And Reveals What"s Under Those Skirts, Getting A Sneaky View Of Those Pale Young Thighs And Ample Asses Wrapped In White Panties

  • censoreduniformschoolgirlSWswitchlight fujimaswitch switchSW-820SW8201sw00820
    • 2021-11-25
    200 min

    [SW-813]C***dhood Friend With A Knee-high Stocking S********l Outfit Gives A Panty Shot, And I Got To See Her Thighs And Panties! She Has Liked Me For A Long Time It Seems, And Hearing Her Cutely Confess Her Feelings Got My Dick So Hard!

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-813SW8131sw00813
    • 2021-06-04
    201 min

    [HUNTB-023]Is This The Stairway To Heaven...？! Flashed With A Panty Shot By A Slutty Older Schoolmate On The Stairs, You Got An Erection, But When She Saw It She Offered To Cut Class And Fuck You On The Roof...!

  • censoredcreampieschoolgirlHUNTBhuntercognac kaminohhh groupHUNTB-023HUNTB023huntb00023
    • 2020-07-20
    120 min

    [AGAV-030]Hip-Shaking Panty Shot Slut - Chiharu Miyazaki Seduces You With Her Ass And Grinds On You Until You Cum

  • chiharu miyazawa censoredschoolgirlbeautiful girlAGAVsex agent daydreamersspilma boysex agentAGAV-030AGAV030agav00030
    • 2020-07-09
    124 min

    [GS-342]I Went To A Sex Club... And To My Surprise, Out Came The Neighborhood Sexy Panty Shot Flashing S*****t!？ This Sexy Female S*****t Lives In The Neighborhood And She Wears Her Skirts So Short That She's Always Flashing Her Panties Around! A

  • censoreduniformschoolgirlGSsosoru x garconspada ikebukuroGS-342GS342h-101gs00342
    • 2020-06-25
    209 min

    [DANDY-718]This S********l Came To See Me In The Hospital And She Got Me Hard By Flashing Panty Shot Action At Me And Teased Me With A Blowjob And Made Me Cum And When My Dick Was Super Sensualized She Started Sucking On My Tip And Gave Me A Cleanup

  • censoredschoolgirlblowjobDANDYdandytenderloin nakamoriDANDY-718DANDY7181dandy00718
    • 2020-04-11
    196 min

    [MIRD-201]Beautiful Y********l Panty Shot Harem Hot Y********ls Love To Make Cocks Explode Akari Mitani Mitsuki Nagisa Miku Abeno

  • mitani akari scooping censoreduniformschoolgirlMIRDmoodyzdragon nishikawamoodyz realMIRD-201MIRD201mird00201
    • 2020-02-01
    177 min

    [HUNTA-721]Inside The Foot Warmer, It Was Panty Shot Heaven! I'm Getting All The Cotton Panty Shot Action I Can Handle! Those Panties Are Bulging So Hard I Can See Their Cameltoes And That's Got My Dick Rock Hard! All Of These Little Honies C

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-721HUNTA721hunta00721
    • 2019-12-12
    181 min

    [SW-672]Every Morning I Would See This Panty Shot Sch**lgirl In Knee-High Socks And She Was So Cute That She Made My Cock Rock Hard, And She Would Puff Up Her Cheeks And Say To Me, "You're Such A Pervert" And Get Mad At Me. But Then She W

  • yui nagase censoredschoolgirlsingle workSWswitchlight fujimaSW-672SW6721sw00672
    • 2019-10-10
    186 min

    [SW-660]Every Morning, I See This Sch**lgirl Flashing Panty Shot Action At Me In Her Knee-High Socks And She Was So Cute That She Was Getting My Dick Hard And Then She Said, "You're Such A Pervert." And Then She Got Mad At Me. But Then He

  • kotone rui censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-660SW6601sw00660
    • 2019-09-12
    159 min

    [SW-654]The Beauty Of A Sch**lgirl In A Ponytail, The Nape Of Her Neck, And Her Panty Shot Pleasure I Was Longingly Looking At Her As She Tied Up Her Hair, And She Was Embarrassed To Be Seen Lifting Her Armpit, And That Made My Heart Leap With Excite

  • censoredschoolgirlSWswitchlight fujimaSW-654SW6541sw00654
    • 2019-07-28
    150 min

    [MMUS-034]A Devilishly Provocative Beautiful Girl - Mitsuki Nagisa

  • scooping censoredschoolgirlbeautiful girlMMUSmarriontakato kasaimcpMMUS-034MMUS034mmus00034
    • 2019-07-25
    193 min

    [SW-644]Do You Really Want To See A Young Girl's Pants？ Well Then I'll Show You! With Your Face Trapped Between Her Legs, You'll Be Lost For Words And Out Of Breath! Why Are Boys So Interested In Girl's Pants？ Tell Me! I'll Let Yo

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-644SW6441sw00644
    • 2019-07-25
    147 min

    [RCTD-251]Let's Prank Some Stairs Panty Shot Schoolgirls With A Time Stopping Watch

  • sweet ai sano censoredschoolgirlRCTDrocketscarecrowRCTD-251RCTD2511rctd00251
    • 2019-07-13
    206 min

    [HUNTA-627]Unguarded Panty Shot Action! Is She Doing It On Purpose？ 2 I Work Part-Time At A Convenience Store, And This Sch**lgirl Works There While Wearing Her School Uniform, And Since Her Skirt Is So Short, Whenever She Reaches Up High To Get Some

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-627HUNTA627hunta00627
    • 2019-07-12
    212 min

    [FNEO-030]Attention All Boys! Beware Of Panty Shot Girls! "I'm Sorry For Sitting In Your Seat! But I'm Not Moving! So Instead..." I Couldn't Resist The Panty Shot Temptation Peeking Out From Underneath Her Skirt, And Now I'm

  • hoshizaki seira nanahara emiri censoredcreampieschoolgirlFNEOfirst staryosukefirst star neoFNEO-030FNEO030h-491fneo00030
    • 2019-03-28
    138 min

    [GODR-915]Naive Schoolgirl Panty Shot Festival Panty Shots Have Nothing To Do With It!! Erotic Limbo Dance Punishment Game

  • censoredschoolgirlGODRviphasshigodGODR-915GODR91578godr00915
    • 2019-03-07
    218 min

    [DANDY-653]"I Got A Boner Seeing A Schoolgirl's Panty Shot When She Came To Visit Me In Hospital And She Gave Me A Teasing Blowjob For 30 Minutes, Then I Gave Her A Cum Facial!!" vol. 1

  • censoredschoolgirlblowjobDANDYdandymagical kikutasoDANDY-653DANDY6531dandy00653
    • 2019-03-01
    134 min

    [MMUS-031]Little Devil Flirting Gal Rin Sasahara

  • sakihara ri censoredschoolgirlMMUSmarriontakato kasaimcpMMUS-031MMUS031mmus00031
    • 2019-01-17
    172 min

    [HUNTA-544]An Innocent Panty Shot! But What If It Wasn't So Innocent After All...？ My Barely Legal Book Shop Coworker Wears Her School Uniform To Work, But Her Skirt Is So Short, She Accidentally Shows Off Her Panties When She Reaches Up To Grab

  • censoredschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-544HUNTA544hunta00544
    • 2018-12-07
    122 min

    [SLAP-044]Tempting Schoolgirl See-Through Chair Up Close And Personal Full Panties Action 2

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-044SLAP044slap00044
    • 2018-11-03
    195 min

    [GDHH-126]"What's Inside My Pussy!？ Please Take It Out...!" My Childhood Friend Is Always Prancing Around Scantily Clad, So While She Was Taking A Nap, I Secretly Inserted An Egg Vibrator Into Her Pussy! And When I Flipped The Switch, She

  • censoredschoolgirlGDHHprime timekorosukehhh groupGDHH-126GDHH126gdhh00126
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2018-09-23
    127 min

    [GROO-047]Groovin' Striptease Super Mini Skirt High School Girls 2

  • censoredschoolgirlGROOdigital arcdigital arkGROO-047GROO047groo00047
    • 2018-09-21
    118 min

    [BUBB-074]Give Us More Schoolgirl Babes On The Stairs SPECIAL RED

  • censoredschoolgirlBUBBeitenfujieda ryuzoextracurricular activitiesBUBB-074BUBB074436bubb00074
    • 2018-09-15
    119 min

    [SSNI-308]Tsundere Little Sister Tempts Me Everyday With Vulnerable Panty Shots Yura Kano

  • yura kanno censoredschoolgirlbeautiful girlSSNIs one number one stylekyouseis1 no 1 styleSSNI-308SSNI308ssni00308
    • 2018-09-06
    127 min

    [IENE-927]Knee High Heaven! Godsend Panty Shots Of 5 Classmates Who Came To See Me

  • meiko mr koizumi yuri mochida censoredschoolgirlIENEi energyie nergyIENE-927IENE9271iene00927
    • 2018-09-06
    177 min

    [SW-581]Every Morning I See Her Knee-High Socks And Luscious Thighs V This Panty Shot Schoolgirl Is So Cute That When My Dick Got Hard For Her, She Blushed And Said Angrily, "You're Such A Pervert!" But Then She Looked At Me With Teary Ey

  • ayuha ami censoredschoolgirlSWswitchlight fujimaswitch switchSW-581SW5811sw00581
    • 2018-09-02
    197 min

    [HUNTA-490]I Am The Only Guy In Class Full Of S Level Beautiful Girls - My Harem! Mischievous Girls Roll Up Their Skirts And Let Down Their Jersies..

  • censoredschoolgirlHUNTAhuntermorikihhh groupHUNTA-490HUNTA490hunta00490
    • 2018-09-02
    126 min

    [SLAP-040]Panty Shot Company 9

  • censoredschoolgirlSLAPdigital arkupdatingSLAP-040SLAP040slap00040
    • 2018-08-27
    139 min

    [MEKI-001]It's A Red-Hot Summer Day, But The Air Conditioner Is Broken!？ I Was Watching This Innocent Girl In Her Schoolgirl Uniform And It Was So Hot She Stuck A Fan Down Her Panties Underneath Her Skirt... Well, If You're A Real Man, There&

  • censoredschoolgirlMEKImercurymushroomMEKI-001MEKI001h-1133meki00001
    • 2018-08-20
    93 min

    [SLAP-038]Stairway: Schoolgirls In Tiny Miniskirts Show Their Panties Walking Up The Stairs 6

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-038SLAP038slap00038
    • 2018-08-10
    99 min

    [BUHD-014]Whispering Schoolgirl Masturbation Training HD 1, 2, 3 Performance With All Actresses B Side

  • maria wakatsuki araki mai censoredschoolgirlBUHDeitenfujieda ryuzoextracurricular activitiesBUHD-014BUHD014436buhd00014
    • 2018-08-08
    109 min

    [ARM-693]I Was Suddenly Seduced By Panty Shots So I Hid And Jerked Off. 16

  • tsukihi sugano ishihara rurica censoredschoolgirlslutARMaroma planningaromaARM-693ARM693arm00693
    • 2018-08-05
    131 min

    [GROO-046]groovin' Super Mini Skirt High School Girls Panty Shot Disco 15

  • censoredschoolgirlGROOdigital arcdigital arkGROO-046GROO046groo00046
    • 2018-08-05
    240 min

    [HUNTA-477]Girls Who Are Standing In Bookstores And Getting Their Pussies Wet Are Ready And Willing To Be Fucked! She's Gonna Stand On Her Tippy Toes As She Bends Over Backwards In Orgasmic Ecstasy! Are Girls Who Stop By Bookstores Near The Train

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-477HUNTA477hunta00477
    • 2018-07-29
    136 min

    [MMUS-023]Provocative And Devilish Beauty Suzu Yamai

  • suzu yamai censoredschoolgirlbeautiful girlMMUSmarriontakato kasaimcpMMUS-023MMUS023mmus00023
    • 2018-06-29
    94 min

    [BUBB-071]Story Of The Stairway Schoolgirl Slut Yui Kawagoe

  • yui kawagoe censoredschoolgirlBUBBeitenfujieda ryuzoextracurricular activitiesBUBB-071BUBB071436bubb00071
    • 2018-06-24
    135 min

    [MMUS-022]A Tempting Little Devil Beautiful Girl Mari Takasugi

  • mari takasugi censoredschoolgirlbeautiful girlMMUSmarriontakato kasaimcpMMUS-022MMUS022mmus00022
    • 2018-06-21
    139 min

    [RCTD-116]My School Started A Knee High Socks And Ultra Miniskirt Uniform Policy, And I'm The Only Boy In The Entire School

  • yuna ishikawa hinano kanzaka censoredschoolgirlRCTDrocketroute yamazakiRCTD-116RCTD1161rctd00116