sister upskirt censored jav high vision




FC2DASDMIAABBANHUNTBONEZSSNICESDDTTROYDSTARSSPRDMIDVAVSAMEYDAWDSANKSBJSDABNNPJSQTE

2022-01-28
149 min

[MIDV-041]My Younger Sister Is Good At Tempting Men With Panty Shots - Mio Ishikawa

  • ishikawa mio censoredbeautiful girlsisterMIDVmoodyzkyoseimoodyz divaMIDV-041MIDV041midv00041
    • 2022-01-13
    201 min

    [SW-821]Lewd Education For Older Step-sister. She"s All Grown Up Now With A Curvy Body, And She Gets A Big Lesson From A Hard Dick!

  • censoredbig titssisterSWswitchyocchanswitch switchSW-821SW8211sw00821
    • 2021-11-19
    236 min

    [HUNTB-147]"You Saw My Underwear Just Now, Right？" A Perverted Lady Tries To Give Me A Boner With A Suggestive Panty Shot That Has To be On Purpose With The Way She Spreads Her Legs

  • censoredcreampieslutHUNTBhuntermorikihhh groupHUNTB-147HUNTB147huntb00147
    • 2021-11-05
    184 min

    [HUNTB-139]A Dream Threesome! Step-sister Went Out Partying With Her Female Friend And Missed The Last Train Home, Now They"re At My Apartment Laying In Bed With Me! The Toss And Turn In Bed, Revealing Their Panties And Breasts...

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-139HUNTB139huntb00139
    • 2021-10-30
    131 min

    [MMUS-058]A Couple of Exciting Gals Who Are Temptresses. Sarina Momonaga, Himari Kinoshita

  • sarina momonaga himari kinoshita himari hanazawa censoredslutMMUSmarrionkasai kijinkcpMMUS-058MMUS058mmus00058
    • 2021-10-21
    137 min

    [PARM-169]Super Real!! Model Let Me Take Pictures Of Her Wet Panties

  • censoredbeautiful girlPARMaroma kikakumousou chirarizumuPARM-169PARM169parm00169
    • 2021-10-21
    198 min

    [SW-807]Step-brother Has A Super Lovable Step-sister With No Bra And A Panty Shot For Lewd Temptation! It"s Going To Be Way Too Hard To Resist. Isn"t Her Body Just So Hot Looking These Days？! Ena Satsuki

  • ena satsuki censoredsistersingle workSWswitchraito fuji makotoswitch hibinoSW-807SW8071sw00807
    • 2021-10-07
    214 min

    [SW-803]Step-sisters" Skirts Are Too Short And Reveal Their Panties! They Show Off Their Lewd Acts And Masturbation To Their Step-brother, Making Him Lose It And Fuck Them Hard When Nobody"s Home!

  • censoredsisterSWswitchyocchanswitch hibinoSW-803SW8031sw00803
    • 2021-10-01
    117 min

    [MIAA-506]I Couldn"t Help Myself After My Provocative Stepsister Kept Showing Me Glimpses Of Her Panties, Starring Hana Shirato

  • white peach censoredcreampiebeautiful girlMIAAmoodyzdoragon nishikawaminna no kikatanMIAA-506MIAA506miaa00506
    • 2021-09-23
    197 min

    [SW-800]Friend Has A Step-sister With A Big Curvy Ass That Tempts A Dick With A Panty Shot. Once It"s Just The Two Of Them He Gets Masochistic And She Gets Lewd, Leading To Her Big Ass And Hips Taking Wild And Hard Pounding!

  • censoredSWswitchyocchanswitch hibinoSW-800SW8001sw00800
    • 2021-09-23
    124 min

    [GS-404]She"s Pretending To Be A****p, Unguarded, And Luring You In, Because She"s A Sweaty Little Devil, Your Little Stepsister!! One Hot Summer Day, While Our Parents Were Away, I Noticed My Little Stepsister"s Panties Were Dripping Wet

  • censoredsisterGSsosoru garconreddo bo ruGS-404GS4041gs00404
    • 2021-07-23
    140 min

    [MMUS-055]My Step Sister Gives Me Panty Shots Without Realizing. Embarassed Young Beautiful Girl Ichika Nagano

  • ichika nagano censoredsistersingle workMMUSmarrionkijin kasaikcpMMUS-055MMUS055mmus00055
    • 2021-07-14
    204 min

    [HUNTB-061]"If You Keep Pounding Me Like This I'm Going To Lose It!" Virgin Cherry Boy Has It Popped By His Slutty Stepsister And Drives Her To A Real Orgasm! Pinned With Her Tight Legs Wrapped Around Him...

  • censoredcreampieschoolgirlHUNTBhuntermorikihhh groupHUNTB-061HUNTB061huntb00061
    • 2021-05-20
    158 min

    [DANDY-765]I'm On The Last Train Home, And To My Surprise, Me And This Slut Are The Only Ones On Board! She Was Sitting Across From Me, Flashing Panty Shot Action And The Temptation Of Her Beautiful Legs Gave Me A Serious Erection, And I Was Done

  • censoredslutDANDYdandybacon tanakaDANDY-765DANDY7651dandy00765
    • 2021-04-14
    159 min

    [ROYD-051]"Come Live With Me Again!" Our Parents Split When We Were K*ds, But Now My Stepsister Wants To Move In With Me Again, Eight Years Later! She's Grown Into An Adorable Young Woman Who Wants My Creampie Every Single Day Mao Watanab

  • mao watanabe censoredcreampieschoolgirlROYDroyalkoichi davidsonhhh groupROYD-051ROYD051royd00051
    • 2021-03-01
    140 min

    [PVT-017]Voluptuously Erotic Elder Stepsisters Will Lure You To Panty Shot Masturbation Temptation 2

  • censoredlingeriePVTsarutoru video publisherpink velvetPVT-017PVT017h-897pvt00017
    • 2021-02-28
    145 min

    [LULU-060]It's Late At Night At The Office, And I'm Alone, Working Overtime With My Married Woman Lady Boss! She Was Seated At Her Desk, Facing Me, Flashing Her Beautiful Legs And Panty Shot Action At Me, And When I Gave In To Her Temptation,

  • tsukino luna censoredcreampiesingle workLULUlunaticsluminaxLULU-060LULU060lulu00060
    • 2021-01-08
    108 min

    [ARM-941]If You're Going To Cum, Make Sure It's On My Tighs!

  • suzuka walnut sarina kurokawa censoredARMaroma planninghamu oujiaromaARM-941ARM941arm00941
    • 2021-01-01
    97 min

    [DOKS-533]Straddling Men's Faces To Show Off Their Panties & Pussy Gets Them Wet - Reverse Angle Masturbation

  • kasagi ichika mai takeda censoredschoolgirlDOKSoffice k sfechi nioffice ksDOKS-533DOKS53336doks00533
    • 2020-12-02
    131 min

    [ARM-928]Girls Cum By Rubbing Their Pussies On Men's Body Parts

  • nanako miyamura sakura miyuki censoredARMaroma planninghamu oujiaromaARM-928ARM928arm00928
    • 2020-11-13
    116 min

    [VRTM-520]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her! 2

  • aishin shinkawa kurata mao censoredslutVRTMv r producegoro koenjiVRTM-520VRTM520h-910vrtm00520
    • 2020-10-17
    122 min

    [SSNI-898]My Stepsister's Been Tempting Me With Her Panty Shots For The Past Three Years, So I Finally Crossed The Line. Sayaka Otoshiro

  • otoshiro sayaka censoredbeautiful girlsisterSSNIs1 no 1 stylejo asagiriSSNI-898SSNI898ssni00898
    • 2020-10-17
    239 min

    [HUNTA-873]Hot Hard-Working Girls (Nurses, Teachers, Office Workers...) So Lost In Their Jobs That They Don't Notice They're Flashing Guys With A Panty Shot - And Getting Them Rock Hard!

  • censoredblowjobHUNTAhuntermorikihhh groupHUNTA-873HUNTA873hunta00873
    • 2020-10-14
    62 min

    [NYH-040]My Friend's Older Sister Lured Me To Temptation With Her Colossal Tits And Panty Shot Action Natsuko-san's Titties Natsuko Mishima

  • natsuko mishima censoredbig titssingle workNYHdirectorsmeow meow houseNYH-040NYH0401nyh00040
    • 2020-10-14
    42 min

    [NYH-039]Her Sexy Bootie Got Me Hard With All Those Flashes Of Her Panties, So She Let Me Stick It In Her - Me And Miku Miku Abeno

  • miku abe censoredsingle workNYHdirectorsmeow meow houseNYH-039NYH0391nyh00039
    • 2020-09-17
    215 min

    [HUNTA-853]I Was Practicing Some Hard Deep Throat Piston Pumping Action With My Pushover Little Sister-In-Law, When She Got Her Pussy So Dripping Wet That She Started To Massively Stain Her Panties!! I Had Just Finished Unloading My Cock Into Her Thr

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-853HUNTA853hunta00853
    • 2020-08-01
    239 min

    [HUNTA-823]"You Got Hard For Me？" "Oh No! I Might Wanna Fuck!？" My Friend's (Slut) Won't Stop Squeezing My Virgin Dick And Makes Me Creampie Her Over And Over!

  • censoredcreampieslutHUNTAhuntermorikihhh groupHUNTA-823HUNTA823hunta00823
    • 2020-07-24
    150 min

    [MIDE-806]When Our Parents Aren't Looking, She's Luring Me To Panty Shot Temptation! This Tsundere Little Stepsister Enjoys Teasing Her Lolita-Obsessed Big Stepbrother!! Yui Shirasaka

  • yui shirasaka censoredschoolgirlsisterMIDEmoodyzgoemonmoodyz divaMIDE-806MIDE806mide00806
    • 2020-07-23
    240 min

    [SW-716]My Big Stepsister's Pretty Ass Panty Shot Action Is Like The Devil's Temptation! "I'll Teach You The Pleasures Of A Woman's Body, But We'll Have To Keep This A Secret From The Rest Of The Family!" A Big Stepsiste

  • censoredsisterSWswitchyocchanswitch switchSW-716SW7161sw00716
    • 2020-06-27
    119 min

    [MIDE-795]Private Tutor Nao's "Creampie OK" Dirty Talk & Temptation Panty Shot Lesson - Nao Jinguji

  • jinguji temple nao censoredcreampieslutMIDEmoodyzdragon nishikawamoodyz divaMIDE-795MIDE795mide00795
    • 2020-06-14
    229 min

    [HUNTA-790]When I Went Home For The First Time In Years, I Found These Excessively Horny Ladies Waiting For Me, And They All Fucked Me, One After Another, Until I Was Drained! These Ladies Were Positively Too Erotic To Handle! I Could Tell From The W

  • censoredHUNTAhunterkawajirihhh groupHUNTA-790HUNTA790hunta00790
    • 2020-05-16
    154 min

    [ROYD-009]When I Spent All Night With My Severe And Skinny Big Tits Lady Boss, She Let Me Get An Exclusive Peek At Her True Self, And That Made Me Want Her For Myself. Yu Shinoda

  • shinoda yu censoredbig titssingle workROYDroyalkawajirihhh groupROYD-009ROYD009royd00009
    • 2020-05-02
    237 min

    [HUNTA-771]When I Moved To Tokyo, I Got An Apartment Located Only 5 Minutes From My Trade School, And I've Been Enjoying The Single Life! But Every Day, The Girls From Class Have Been Coming Over To Spend The Night... 2 It Was My First Time Livin

  • censoredblowjobHUNTAhunterkawajirihhh groupHUNTA-771HUNTA771hunta00771
    • 2020-04-11
    121 min

    [IPX-473]A Stepsister Shows Her Panties To Her Annoying Stepbrother - Tsumugi Akari

  • akari tsumugi censoredcreampiesingle workIPXidea pocketk westdishIPX-473IPX473ipx00473
    • 2020-04-04
    229 min

    [HUNTA-755]"Fine, I'll Sleep With You Today. I'll Make You Feel Better! But It's Just For Today!" When I Got Home After Being Dumped...

  • censoredcreampieHUNTAhuntermorikihhh groupHUNTA-755HUNTA755hunta00755
    • 2020-03-26
    221 min

    [SW-692]My Sister And Her Friends Are Horny Little Devils! They're All Cumming Over To My House And Tempting Me With Miniskirt Panty Shot Action. And When My Little Sister Stepped Away, They Said It Was OK For Me To Film Some POV Videos With Them

  • censoredSWswitchyocchanswitch switchSW-692SW6921sw00692
    • 2020-03-13
    120 min

    [VRTM-488]"I'm Not Gonna Let You Cum!" - A Private Tutor In Knee Socks Does Cum Control On Her Cherry Boy S*****t! - She Makes Him Save It Up Until He's Ready To Explode, Then Finally Lets Him Cum Inside Her!

  • manami oura miho tsuno censoredslutVRTMv r producegoro koenjiVRTM-488VRTM488h-910vrtm00488
    • 2020-02-15
    212 min

    [AP-745]At The Hot Spring Resort A Night Visit With My Little Stepsister When Our Parents Got Remarried, I Was F***ed To Go With Them On Their Honeymoon, And I Ended Up Sharing A Room With My New Little Stepsister We Had Never Met Before, But She Tre

  • censoredcreampiesisterAPapachebarracudahhh groupAP-745AP745ap00745
    • 2020-01-23
    160 min

    [SW-680]The Girls In My Neighborhood Sit On The Stairs In Miniskirts With Their Panties Showing, And Their Panties Are Dripping Wet! - They're Just Waiting For Someone To Pull Their Panties Aside And Give Them A Good Fucking! - I Thrust My Cock D

  • censoredSWswitchyocchanSW-680SW6801sw00680
    • 2020-01-16
    222 min

    [HUNTA-709]I'm Getting Knocked Out By That Tight Little Ass She's Thrusting At Me!! My Little Sister-In-Law Has A Super Beautiful Ass And A Godly Ass And I Creampie Fucked Her Over And Over Again!! I Suddenly Got A New Little Sister-In-Law, A

  • censoredcreampieschoolgirlHUNTAhuntermorikihhh groupHUNTA-709HUNTA709hunta00709
    • 2020-01-09
    180 min

    [SW-677]My Stepmom's Big Tits And My Stepsisters' Perky Asses In Their Miniskirts Are Mine For The Taking! - When My Dad Got Remarried I Suddenly Got A Slutty Stepmom And Two Slutty Stepsisters, And They're Always Tempting Me With Their B

  • censoredbig titssisterSWswitchyocchanSW-677SW6771sw00677
    • 2019-12-13
    119 min

    [VRTM-471]This Kind And Gentle Big Ass Big Stepsister Was Wearing A Tight Skirt And Exerted Her Total Domain Over A Horny Little Stepbrother! When She Was Given Aphrodisiacs, She Started To Rub Her Knee-High Socks Against Him And Dripped Juicy Stains

  • nanako miyamura ririka censoredcreampiesisterVRTMv r producegoro koenjiVRTM-471VRTM471h-910vrtm00471
    • 2019-11-30
    227 min

    [HUNTA-686]I'm In A Cramped Bathtub With My Excessively Big Tits Big Stepsister! I Was Getting Fucked For 3 Days And 2 Nights And Now I Was At My Absolute Limit! My Big Stepsister Came To Town To Stay With Me At My Small Apartment...

  • censoredcreampiesisterHUNTAhunterkawajirihhh groupHUNTA-686HUNTA686hunta00686
    • 2019-11-14
    240 min

    [HUNTA-684]I Moved To Tokyo And Now I Live In An Apartment Located 5 Minutes From My Trade School! But Every Day, The Girls From Class Come Over To Spend The Night... I Was Enjoying My Life, Living On My Own...

  • censoredblowjobHUNTAhunterkawajirihhh groupHUNTA-684HUNTA684hunta00684
    • 2019-11-14
    179 min

    [HUNTA-682]Hey... Who Do You Want To Fuck First？ I Suddenly Ended Up With A New Sister-In-Law And We're Sharing A Room Together Too! We Were Sleeping Together And Then I Was Having A Miraculous, Divine Threesome Experience!! When Our Parents Got

  • censoredblowjobsisterHUNTAhuntermorikihhh groupHUNTA-682HUNTA682hunta00682
    • 2019-11-02
    187 min

    [HUNTA-676]I Was Practicing Some Hard Deep Throat Piston Pumping Action With My Pushover Little Sister-In-Law, When She Got Her Pussy So Dripping Wet That She Started To Massively Stain Her Panties!! I Had Just Finished Unloading My Cock Into Her Thr

  • censoredsisterdeepthroatHUNTAhuntermorikihhh groupHUNTA-676HUNTA676hunta00676
    • 2019-10-24
    184 min

    [SW-662]This Tsundere Little Stepsister Is Giving Her Big Stepbrother Some Loving Panty Shot Action My Little Stepsister Has Grown Up Into Just The Kind Of Babe I Like, And Then She Turned The Tables On Me And Lured Me To Temptation, Saying, "I W

  • yui nagase censoredsistersingle workSWswitchlight fujimaswitch switchSW-662SW6621sw00662
    • 2019-09-26
    159 min

    [SW-655]My Stepsister And Her Friends Are Devilish Little Sluts! They Came Over To My House And Lured Me To Miniskirt Panty Shot Temptation, And While My Little Stepsister Was Looking The Other Way, I Shoved My Big Orgasmic Cock Into Their Pussies An

  • censoredslutsisterSWswitchyocchanswitch switchSW-655SW6551sw00655
    • 2019-09-20
    241 min

    [DOCP-172]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again! vol. 2

  • yui nagase natsuho imai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-172DOCP172118docp00172
    • 2019-09-13
    107 min

    [VRTM-452]"Oh My... You Aren't Trying To Lure Me To Temptation, Are You...？" He Was Alone In The House With His Big Brother's Girlfriend, And All She Was Wearing Was A Single Button-Down Shirt, And No Bra Over Her Big Tits! He Could S

  • anne mashiro hamazaki mao censoredcreampiebig titsVRTMv r produceken hosokawaVRTM-452VRTM452h-910vrtm00452
    • 2019-09-13
    121 min

    [VRTM-453]This Little Brother-In-Law Is Lusting For His Kind And Gentle Big Ass Big Sister-In-Law Who Wears A Tight Skirt! When He Gave Her Aphrodisiacs To Drink She Started Rubbing Her Knee-High Socks Up Against Him And Staining Her Panties, And The

  • otsuki sound yuki sakuragi censoredcreampiesisterVRTMv r producerokutanzo no seishiVRTM-453VRTM453h-910vrtm00453
    • 2019-09-12
    110 min

    [GS-282]This Little Stepsister Is Wearing A Short Uniform Skirt, And She's Always Flashing Panty Shot Action At Me! When I Warned Her, She Started Wearing Bloomers To Prevent Any More Panty Shot Action!？ But She Has No Problem Flashing Her Crotch

  • censoreduniformsisterGSsosoru x garconkinton kuriGS-282GS2821gs00282
    • 2019-09-05
    166 min

    [SSNI-555]I Can See My Girlfriend's Sister's Panties! My Girlfriend Is Right Next To Us But Her Slutty Older Sister Brazenly Tries To Seduce Me! Moe Amatsuka

  • angel moe censoredslutsingle workSSNIs1 no 1 stylegoemonSSNI-555SSNI555ssni00555
    • 2019-08-16
    162 min

    [SSNI-550]This Tsundere Little Sister-In-Law Is Prancing Around Without A Care In The World, Flashing Panty Shot Temptation Every Day Mako Iga

  • iga mako censoredschoolgirlsisterSSNIs1 no 1 stylekyoseiSSNI-550SSNI550ssni00550
    • 2019-08-08
    128 min

    [GS-277]My Sister-In-Law Came To Visit While My Wife Was Out! She Lounged Around The House With No Bra And Her Panties Showing! I Didn't Know Where To Look, So I Turned The TV On, But I Forgot I'd Left A Porno DVD In The Machine...!

  • censoredsisterGSsosoru x garconona pGS-277GS2771gs00277
    • 2019-08-03
    184 min

    [HUNTA-633]I Was Surrounded By My Slutty Sisters-In-Law On A Triple Bunk Bed, And Now I Was Lured To Temptation From The Top And From The Bottom! When My Parents Got Remarried, I Got A New Big Sister-In-Law And A New Little Sister-In-Law. Since Our H

  • censoredsisterHUNTAhunterkawajirihhh groupHUNTA-633HUNTA633hunta00633
    • 2019-07-25
    117 min

    [GS-273]My Cock Gets Commandeered By A Sexy Scary Lady! The Woman Who Lives Upstairs Is Beautiful, But She Never Says Hello To Me. I Can See Up Her Miniskirt When She Walks Up The Stairs, But Is She Showing Me Her Panties On Purpose...？

  • censoredcreampieGSsosoru x garconspada ikebukuroGS-273GS2731gs00273
    • 2019-07-13
    240 min

    [HUNTA-626]My Room Was So Hot, My Sister And Her Friends Decided To Get Out Of Their Clothes And Into Something Skimpier, And That Got Me Fully Rock Hard! During Summer Break, My Little Sister-In-Law Brought Her Friends Over, But Our Air Conditioner

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-626HUNTA626hunta00626
    • 2019-07-11
    180 min

    [SW-640]When My Parents Got Remarried, I Got Some Little Devil Sisters-In-Law Who Were Luring Me To Miniskirt Panty Shot Temptation! I Was Always An Only Child, But Now, These Girls Were Living Under The Same Roof As Me, And Showing Off By Changing I

  • censoredsisterSWswitchyocchanswitch switchSW-640SW6401sw00640
    • 2019-06-15
    170 min

    [HUNTA-613]"Please Let Me Go! You're Going To Break Me!!" I Couldn't Control Myself Because My Stepsister Is So Careless. I Hold Her Ankles Down And Continuously Creampie Her From Behind Until She Has Convulsive, Intense Orgasms And T

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-613HUNTA613hunta00613