slender beautiful girl tits def javcensored




FC2ONEZMIAANACXDASDROYDMVSDCHRVFSDSSHDKACESDPREDSPRDHUNTBBLKVEMASQTEBBANRBDWANZEBOD

2024-05-03
151 min

CAWD-659 I Want More Than Getting Married!Muramura Explosion Fully Opened!An Unusual 3rd Production Miyu Sasaki Who Keeps Seeking Even If The Constricted Body Is In Close Contact

  • sasaki miyu censoredbig titsbeautiful girlCAWDkawaiitrendy yamaguchiCAWD-659CAWD659cawd00659
    • 2024-04-26
    720 min

    KWBD-368 Shikaku Yuhihi KAWAII*1st Anniversary SEX Is The Latest Beast 8 Titles 12 Hours

  • shitara yuhi censoredbig titsbeautiful girlKWBDkawaiiKWBD-368KWBD368kwbd00368
    • 2024-04-26
    74 min

    PKTA-024 P Live Interview Through!Dokata OK Every Time P Girl 24 Nagisa Chan

  • censoredcreampiePKTAp katsu oitanPKTA-024PKTA024h-1749pkta00024
    • 2024-04-25
    198 min

    NHDTB-908 Nipple Development Slut ● Sensitive Leaked Small Breasts Ver.

  • censoredsquirtingNHDTBnatural highraftin maeshirochikanNHDTB-908NHDTB9081nhdtb00908
    • 2024-02-23
    44 min

    AIDV-002 The World"s First AI Actress Ai Kihana Is Lifted!Initial Creampie Sexual Intercourse

  • kibana ai censoredcreampiebig titsAIDVh m pcrestfantasyAIDV-002AIDV0025642aidv00002
    • 2024-02-22
    145 min

    KANO-024 Creampie Room Drink Icharab Natural G Cup Musaka Yui Arisaka

  • arisaka yui censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-024KANO0241kano00024
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-01-26
    26 min

    NJPD-010 Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlNJPDnew japan av actress directorynew japan av actress directoryNJPD-010NJPD010h-1754njpd00010
    • 2024-01-25
    140 min

    KANO-018 Amateur Sex Lovey-dovey Creampie VOL.3 Rei & Niina

  • misumi rei it s in tomikunaga censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-018KANO0181kano00018
    • 2024-01-12
    93 min

    ORECS-096 Memories Of Being Attacked By Beautiful Girls At A Hot Spring Inn Rei Hinako Suzu

  • censoredcreampieschoolgirlORECSmy amateur z second impactORECS-096ORECS096h-1732orecs00096
    • 2024-01-12
    142 min

    ORECS-095 7P Big Orgy In Open Air Bath & 6 Beautiful Girls In Uniform Harem SEX With Full Body Licking

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-095ORECS095h-1732orecs00095
    • 2023-10-13
    60 min

    FTHT-164 "Can You Please Touch My Dick？" An Amateur Girl Gives Me A Hand Job And A Blowjob, And I Ejaculate A Lot! 02

  • censoredbig titsamateurFTHTfaleno tubedavielFTHT-164FTHT1641ftht00164
    • 2023-10-13
    120 min

    ORECS-053 Half JD Rin & Beautiful Big Tits JD Misa"s Brain-bugging Convulsions Climax Sex If You Can Endure The Amazing Techniques Of A Handsome AV Actor, You"ll Get 1 Million Yen! Once She Cums, She Mercilessly Cums Raw With A High-speed Pis

  • censoredcreampiebig titsORECSmy amateur z second impactone topORECS-053ORECS053h-1732orecs00053
    • 2023-10-07
    266 min

    XVSR-729 MGC ACT.4 MAX GIRLS COLLECTION 2023 Hikage Hinata, Sarina Momunaga, Hitomi Honda, Ena Satsuki

  • hinata hikage sarina momonaga censoredbeautiful girlXVSRmax adr pcalenXVSR-729XVSR729xvsr00729
    • 2023-09-29
    33 min

    CLT-073 THE F1RST SEX No 06 Manatsu Misakino

  • misakino manatsu censoredblowjobbeautiful girlCLTpeterskawanakajima susumuCLT-073CLT073h-021clt00073
    • 2023-09-28
    120 min

    FVMD-017 Beautiful BODY Exercise Popular Y●uT●ber Erika Ozaki Erika

  • ozaki erika censoredcreampiebeautiful girlFVMDfavemodesamuraifave modeFVMD-017FVMD017h-1668fvmd00017
    • 2023-08-29
    72 min

    EROFV-198 Amateur Female College Student [Limited] Nonoka-chan, 21 Years Old. ! Massive Vaginal Cum Shot SEX While Enjoying The Soft Body That You Can Not Usually Taste! !

  • censoredcreampieuniformEROFVhamedori.network secondeditionlove girlfriendEROFV-198EROFV198h-1472erofv00198
    • 2023-07-14
    130 min

    ORECS-018 Maji God W Angel Advent // Mio-chan (24 Years Old) # Nurse # Superb Slender # Ophthalmologist # Continuous Cum Acme In Nurse Uniform & Acme Walk Outside // JD Yukine-chan // Embarrassed And Embarrassed To Others Seen In Estrus// Wanted Bare

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-018ORECS018h-1732orecs00018
    • 2023-07-08
    242 min

    KTRA-544 Thin And Sensitive Body! Slender Beautiful Girl Best 2 4 Hours

  • monami bell chiaki sato censoredbeautiful girlKTRAk tribeKTRA-544KTRA544ktra00544
    • 2023-06-30
    208 min

    MIDV-403 Amateur Thanksgiving! If You Endure Encouragement Dirty Talk & Angel Tech To The Limit, Mio"s Service SEX Promises The Best Ejaculation Special! Mio Ishikawa

  • ishikawa mio censoredbeautiful girlMIDVmoody szampamoodyz divaMIDV-403MIDV403midv00403
    • 2023-06-30
    88 min

    ORECS-014 Super Beautiful Face // Beautiful Girl Wife // Beautiful Slender BODY // Virgin-kun"s Phimosis ○ Po Wash // Raw Creampie Brush Wholesale // Runa-san (28 Years Old)

  • censoredcreampieblowjobORECSmy amateur z second impactORECS-014ORECS014h-1732orecs00014
    • 2023-06-30
    150 min

    MIFD-241 Rookie Take Off And Amazing Constriction G Cup! Mugyuu! And A Cute Half-breasted Dental Assistant AVDEBUT Itsukaichi Mei

  • itsukaichi mei censoredbig titsbeautiful girlMIFDmoody smichiru arashiyamamoodyz freshMIFD-241MIFD241mifd00241
    • 2023-06-02
    60 min

    FTHT-129 [Can You See The Masturbation？ 11] Huh？ ？ Didn"t You Just Say Look？ Fare No Chubu Fetish Petite Video Content

  • censoredbig titsbeautiful girlFTHTfaleno tubeFTHT-129FTHT1291ftht00129
    • 2023-05-25
    70 min

    KAMEF-033 Individual Shooting Specialized Campaign Girl Photo Session Narumi-chan (20) Machida Lens"s BLACK KAMEKO FILE.33 Weekly Magazines Featuring Many Corporate Projects Gravure Squirting Individual Shooting A Natural Nasty Model Who Is Shaki

  • censoredcreampiesquirtingKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-033KAMEF033h-1350kamef00033
    • 2023-05-18
    121 min

    FANH-143 Tall Model Almost Virgin JD Aoba-chan 19 Years Old Slender Ma Wearing A Vibrator On A Co.

  • censoredcreampieamateurFANHhamedori.network secondeditionFANH-143FANH143h-1472fanh00143
    • 2023-05-08
    46 min

    NHDTB-78403 The Woman Who Was Bareback When She Was Cuckold On A Night Bus She Lost Her Reason To The Numbing Pleasure Of A Slow Piston And Can'T Reject Vaginal Cum Shot Limited 12 Cuddling Cowgirl Sp Cuddling Cowgirl Sp A Delicate Girl Who Starts Su

  • censoredcreampieschoolgirlNHDTBnatural highjacken kodamanatufileNHDTB-78403NHDTB784031nhdtb78403
    • 2023-05-08
    74 min

    HMDNV-347 [Real Abs] Detaining And Punishing An Active Medical College Student, Losing Her Pride In Hell, Getting Her Cock Fucked-Up, And Shaking Her Hips Back Her Own Private Shot

  • censoredamateurHMDNVhamedori.network secondeditionHMDNV-347HMDNV347h-1472hmdnv00347
    • 2023-05-01
    119 min

    MXGS-1237 Would You Like To Drink Again In My Room？ Ichika Matsumoto Fucked Her Drunk Girlfriend"s Best Friend

  • ichika matsumoto censoredcreampiebeautiful girlMXGSmaxingkaoruMXGS-1237MXGS1237h-068mxgs1237
    • 2023-05-01
    80 min

    EROFV-119 Amateur Female College Student [Limited] Arisu-Chan, 20, A Neat Girl Who Goes To A Famous Women'S College, Dabbles In A Matching App Out Of Interest, Has A Fun Aquarium Date, And After A Fun Aquarium Date, She Goes So Deep And Creampied Hav

  • censoredcreampieamateurEROFVhamedori.network secondeditionlove girlfriendEROFV-119EROFV119h-1472erofv00119
    • 2023-04-22
    127 min

    NCYF-023 Gachi 7P Super Orgy [Continuous Insertion Of Huge Cocks In Minimal Crack] 141cm Minimum Fairy Beautiful Girl Layer Shaved Innocent Body Raw Saddle Vaginal Cum Shot Trampled [Reason Collapse De M Awakening] Idol Beauty Collapses Incontinence

  • amateur censoredcreampiecosplayNCYFall japan amateur photographers union daydream fantasy loversNCYF-023NCYF023ncyf00023
    • 2023-04-13
    124 min

    FANH-133 Aspiring Model Dance Club Madoka-Chan 18 Year Old Homecoming From School Drama She Teaches A Young Pussy With A Super Thick Adult Dick, Live Vaginal Masturbation Pov

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-133FANH133h-1472fanh00133
    • 2023-04-06
    145 min

    MIST-397 At Night With Mary Tachibana... Mary Tachibana Enjoys Sex With A Beautiful Woman At A Hotel

  • tachibana mary censoredcreampiebig titsMISTmr michirusaitaMIST-397MIST3971mist00397
    • 2023-03-30
    160 min

    KAMEF-029 Cosplay Photo Session Mirei Specializing In Individual Shoots Mirei (25) Machida Lens'S Black Kameko File.29 Superb Style Gravure Idol Makes A Bunch Of Oho Voices Completely Rubberless At A Private Photo Session, Pov Orgy Orgy With Duckling

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-029KAMEF029h-1350kamef00029
    • 2023-03-26
    66 min

    HNHU-052 Private Shot Picking Up Girls #Super Sensitive Erotic Nipples Beauty# Slender Beautiful Girl# Creampie# Kinky Fellation# Pov

  • censoredcreampieamateurHNHUthat s rightHNHU-052HNHU052h-1658hnhu00052
    • 2023-03-24
    165 min

    BANK-114 Beautiful Girls Who Bully And Beat Men With A W Provocation, Beautiful Girls With A Smile

  • mio meg ikuta tow censoredcreampieuniformBANKmako bankkintaro okumaBANK-114BANK114h-1495bank00114
    • 2023-03-23
    348 min

    FTHTD-016 Kamigyo-Chan, Who Picks Up Girls On A Solo Girls' Trip, Makes A Fool Of Me Every Time Episode7 Feat.Falenotube

  • censoredcreampiebeautiful girlFTHTDfaleno tubedavielFTHTD-016FTHTD0161fthtd00016
    • 2023-03-02
    86 min

    KAMEF-027 Solo Shoot Specialized Cosplay Photo Session Rentan Machida Lens'S Black Kameko File.27 Personal Shoot With The Greatest Beautiful Girl Private Connection With The Greatest Beautiful Girl Off Paco And No Rubber Raw Pov, Massive Vaginal Cum

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-027KAMEF027h-1350kamef00027
    • 2019-09-05
    479 min

    OFJE-213 Furious Piston-Pounding Second Helping Sex, Relentlessly Pumping Her Orgasmically Twitching And Trembling Pussy All 10 Titles, All Episodes Complete Best Hits Collection 8 Hours

  • angel moe miyu yanagi censoredbig titsbeautiful girlOFJEs one number one styles1 no 1 styleOFJE-213OFJE213ofje00213
    • 2022-04-23
    245 min

    SGKX-017 [Slutty Instagram BEST ＃011] [100 Point GAL"s Big Collection SP] [First Performer] Squirting Shaved Pussy Submissive Beautiful Girl Gets A Creampie For Christmas Special. [Second Performer] GAL. [Third Performer] Sperm Covered Squirting

  • miyu cha himeko cha censoredcreampiebig titsSGKXhame chanyanai ichi gechena kyosukegal suta gramSGKX-017SGKX017h-1575sgkx00017
    • 2022-04-22
    148 min

    SKMJ-278 The Absolute Peak Of Sugar Daddy Fun. Horny Explosion After 30 Days Of No Sex With This Very Horny Hot Y********l. Non Stop Fucking On A Hot Spring Trip (4 Paco, 2 Days).

  • amateur censoredcreampiebeautiful girlSKMJred face girlcountry wajimablush girlSKMJ-278SKMJ278h-1324skmj00278
    • 2022-04-22
    260 min

    SKMJ-280 They"re All Amateur College Girls! Need Them To Come Over For Some Masturbation Assistance For A Cherry Boy Like You？ A Pure, Delicate College Girl Gets A Cherry Boy Dick Hard With Crazy Excitement! Creampie Raw Footage For A Virginity L

  • amateur censoredcreampiebig titsSKMJred face girlone topblush girlSKMJ-280SKMJ280h-1324skmj00280
    • 2022-04-14
    164 min

    KAMEF-004 Amateur Specialty Cosplay Photography Event, Ao-chan (18). Machida Lens BLACK KAMEKO FILE .04 A Naive Idol Is Taken In By Lust. The Kind Face Of An Angel Is Sullied By A Trap Of Pleasure For A Pregnancy Fetish Scenario With Creampie Loads D

  • amateur censoredcreampieuniformKAMEFsuper dimension mugen kamekoKAMEF-004KAMEF004h-1350kamef00004
    • 2022-04-01
    137 min

    HODV-21662 (Abnormal Lust) Unstoppable Follow-Up Orgasmic Fucking In Trance-Spasming Ecstasy!! She May Look Quiet, But She"s A Serious Pervert x A Sensual Body And Infinite Lust x Pale White Skin And A Skinny Body With A Tight Waist And Beautiful

  • tachibana hina censoredcreampiebig titsHODVh m pk c takedaHODV-21662HODV216625642hodv21662
    • 2022-04-01
    120 min

    MIDV-078 While My Wife Was Away For 3 Days Visiting Her Folks, I Was Left With My Stepdaughter, Who Had Big Tits, Was Ripe For Fucking And Still Growing! So I Fucked Her Enough To Last A Lifetime. Mirai Asumi

  • tomorrow s future censoredbig titssquirtingMIDVmoody strendy yamaguchimoodyz divaMIDV-078MIDV078midv00078
    • 2022-04-01
    128 min

    HODV-21663 The Night Is Still Cold, So I"ll Warm You Up By Sucking Your Dick. Sumire Kuramoto

  • sumire kuramoto censoredcreampieblowjobHODVh m pHODV-21663HODV216635642hodv21663
    • 2022-03-18
    120 min

    [SSIS-359]Barely Legal Girl With A Narrow Waist In Uniform Gets Fucked Hard Non-stop While Riding As Her Detestable Huge Teacher Takes Advantage For The 7th Day... Finally Losing Out To Pleasure. Mai Shiomi

  • mai shiomi censoredblowjobSSISs one number one styleinabars1 no 1 styleSSIS-359SSIS359ssis00359
    • 2022-03-11
    150 min

    [FOCS-059]A Fresh Face Extremely Tiny Titty Beautiful Girl Makes Her Debut A Brilliant Math Scholar Barely Legal Babe Uses Her Sensitive Nipples To Solve This Sex Equation! Yui Setouchi

  • setouchi yui censoredFOCSabc delusion groupfocusFOCS-059FOCS059focs00059
    • 2022-03-08
    481 min

    [KTRA-388]Imoto, A Beautiful Girl Who Has Sex With 10 Guys One After Another Vol. 10, 8 Hours, 2-disk Set

  • hinako mori toua kotone censoredbeautiful girlKTRAk tribeKTRA-388KTRA388h-094ktra00388
    • 2022-02-28
    80 min

    [COCH-013]My First Love Is Slender / Yui Tsukino

  • amateur censoredbig titsbeautiful girlCOCHintec inccomachiCOCH-013COCH013
    • 2022-02-25
    301 min

    [SKMJ-262]"Can I Cum Over To Your House？" We"re Going To The Homes Of Amateur Girls And Getting All The Fucking We Want In This Fuck Fest Special (Raw Fucks / Furious Piston-Pounding Thrusts / Creampie Raw Footage / Cum Face Semen Splatte

  • censoredcreampiebig titsSKMJblush girlSKMJ-262SKMJ262h-1324skmj00262
    • 2022-02-17
    122 min

    [FANH-072]Wild And Horny Visual Kei Fan Sagiri-Chan After Live Show Beautiful Crazy Girl Aphrodisiac Fucking Swings Her Hips Multiple Orgasms Begs For Creampie

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-072FANH072h-1472fanh00072
    • 2021-12-17
    150 min

    [EBOD-873]I Get This Feeling That We"re Doing Something Naughty ... This Lo*ita Looks Like She"s In The Throes Of Adolescence, And That"s How Her Personality Plays Out Too, But She"s Got I-Cup Titties An E-BODY Exclusive Debut Aria Os

  • aria oshima censoredbig titsbeautiful girlEBODe bodytrendy yamaguchiEBOD-873EBOD873ebod00873
    • 2021-11-16
    481 min

    [KTRA-350]Sensitive Small Breasts Sex With A Beautiful Girl 10 Girls 8 Hours 2 Discs

  • tomonatsu hamano amane yayoi censoredcreampiebeautiful girlKTRAk tribeKTRA-350KTRA350h-094ktra00350
    • 2021-11-12
    239 min

    [SKMJ-226]A Beautiful Amateur Girl Is Doing Housekeeping At A Man"s House. I"m Not Going To Stop Even If She Comes.

  • censoredcreampieamateurSKMJblush girlyosukeSKMJ-226SKMJ226h-1324skmj00226
    • 2021-10-12
    241 min

    [KTRA-340]Kotone Fuyuai PREMIUM Best 4 Hours

  • toua kotone censoredbeautiful girlKTRAk tribeKTRA-340KTRA340h-094ktra00340
    • 2021-09-04
    141 min

    [PKPD-157]Young, Raven-Haired, Amateur S********l In Pantyhose Is Down For Fucking Raw, Starring Inori Sasage

  • dedication glue censoredcreampiebeautiful girlPKPDpakopako team and pleasant friends delusion groupPKPD-157PKPD157pkpd00157
    • 2021-07-16
    133 min

    [BNST-032]She'll Do Anything I Ask: My Convenient Girl!!

  • censoredblowjobBNSTteacher delusion groupsamuraiBNST-032BNST032bnst00032
    • 2021-04-22
    480 min

    [FCDSS-009]This Intellectual College Girl Wants To Be A Female Anchor, But Right Now She's In The Middle Of Furious Vaginal Orgasmic Piston-Pumping, Cum Pissing Dirty Talk NTR!! Natsu Tojo In Her First Best Hits Collection Full Course Fuck Fest 8

  • natsu tojo censoredbeautiful girlFCDSSfalenofaleno starFCDSS-009FCDSS0091fcdss00009