slender high vision massage refre jav voyeur




FC2CHRVHZGDMIAADASDCJODAWDHDKAPPPDMVSDMILKATIDMEYDAVSABBANNACXPREDWAAAJULVENXSAN

2020-11-01
240 min

[SCR-256]Totally Private Salon - Posting Personal Footage, Highlights Collection - 4 Hours - Every Single Customer Comes Back For More - Do You Indulge In Illicit Sex Or Not？ It's All Up To You-

  • censoredcreampieblowjobSCRglay zs crimeSCR-256SCR25612scr00256
    • 2020-07-01
    123 min

    [SCR-244]Private Room Salon Leaked Footage 4 - A Body Clinic With 100 Satisfaction Rate Where It's Up To You Whether You Get Fucked

  • censoredcreampieblowjobSCRglay zs crimeSCR-244SCR24412scr00244
    • 2020-05-19
    69 min

    [EMOI-010]An Emotional Girl/Her 4th Video/Oil Massage Ecstasy/A Big Dick Massage Therapist/Peeping Hidden Camera Footage/148cm Tall/B-Cup Titties/Rina Hiyuga (22)

  • hyuga rina censoredbeautiful girlsingle workEMOIsod createbacon tanakaemotional girlEMOI-010EMOI0101emoi00010
    • 2020-04-01
    121 min

    [SCR-237]Private Salon Video 3 ~ Body Clinic With A 100 Return Rate Whether The Sex Is Up To Snuff Or Not Is Up To You ~

  • censoredcreampieblowjobSCRglay zs crimeSCR-237SCR23712scr00237
    • 2020-03-13
    192 min

    [RIX-075]Super Strong!! Awakening Her Sensuality With A Sensual Massage Laced With 3 Types Of Aphrodisiacs

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-075RIX075118rix00075
    • 2020-02-14
    149 min

    [RIX-074]Couple Simultaneously Cheating On Each Other While Getting a Massage 2

  • censoredbig titsamateurRIXprestigeno directorrelaxation roomRIX-074RIX074118rix00074
    • 2020-01-10
    178 min

    [RIX-073]A Hawaiian Men's Massage Parlor A Place For Some Lomi Lomi Massage 3

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-073RIX073118rix00073
    • 2019-12-13
    196 min

    [RIX-072]Beautiful Working Marrie Woman's First-Rate Rejuvenating Massage

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-072RIX072118rix00072
    • 2019-11-08
    186 min

    [RIX-071]Streaming Peeping Video Of Repressed Tempting And Provoking Masseuse!!

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-071RIX071118rix00071
    • 2019-11-01
    241 min

    [BUR-535]Whether You Can Fuck Her Or Not Is Up To You! Sexual Negotiations With A Pushover Massage Parlor Therapist Peeping Videos 4 Hours

  • censoredcreampiebig titsBURglay zburst graceBUR-535BUR53512bur00535
    • 2019-10-11
    188 min

    [RIX-070]Feels So Good, It Will Put Anyone Into A Deep Sleep A Waterless Head Spa Massage Peeping Videos

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-070RIX070118rix00070
    • 2019-09-28
    225 min

    [CLUB-580]Specializing In Beautiful Office Ladies Located In Nakano Ward This Clinic Promises To Treat Their Patients' Sensual Spots And Guarantees Ecstatic Pissing Pleasure 4

  • censoredsquirtingCLUBhentai shinshi clubCLUB-580CLUB580club00580
    • 2019-09-13
    236 min

    [RIX-069]Private Room Schoolgirl Sexual Massage Peeping 3

  • censoredamateurbeautiful girlRIXprestigerelaxation roomRIX-069RIX069118rix00069
    • 2019-08-31
    237 min

    [CLUB-577]The Total Domain Of Girls In Uniform And Knee-High Socks They Giving Me A Dirty Talk Footjob And Forced Me To Cum Over And Over Again.

  • censoredCLUBhentai shinshi clubCLUB-577CLUB577club00577
    • 2019-08-09
    231 min

    [RIX-068]The UV Treatment Oil Salon Where Beautiful Girls In Bikinis Stop By On The Way Home From Swimming At The Beach 2

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-068RIX068118rix00068
    • 2019-07-12
    230 min

    [RIX-067]Business Hotel Business Trip Massage Voyeur 4

  • censoredbig titsRIXprestigerelaxation roomRIX-067RIX067118rix00067
    • 2019-07-05
    245 min

    [DNW-040]After She Puts On Her Uniform 9

  • censoredcreampiebig titsDNWprestigedocument nowDNW-040DNW040118dnw00040
    • 2019-07-01
    120 min

    [SCR-221]A Private Salon Posting Video 2 - We Wanted To See If This Body Clinic With A 100 Repeat Rate Would Let Us Fuck, But That All Depends On You -

  • censoredcreampieblowjobSCRglay zs crimeSCR-221SCR22112scr00221
    • 2019-06-29
    178 min

    [CLUB-564]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 34

  • censoredbig titsCLUBhentai shinshi clubCLUB-564CLUB564club00564
    • 2019-06-14
    129 min

    [RIX-066]Couple Simultaneously Cheating On Each Other While Getting a Massage

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-066RIX066118rix00066
    • 2019-06-07
    262 min

    [DNW-036]I Forgot To Turn Off These POV Videos 9

  • censoredcreampiebig titsDNWprestigedocument nowDNW-036DNW036118dnw00036
    • 2019-05-10
    206 min

    [RIX-065]A Hawaiian Men's Massage Parlor A Place For Some Lomi Lomi Massage 2

  • censoredbig titsamateurRIXprestigerelaxation roomRIX-065RIX065118rix00065
    • 2019-05-01
    121 min

    [SCR-217]Complete Private Salon Fucking Creampie Secret Connection Filthy Peeping 1

  • censoredcreampieblowjobSCRglay zs crimeSCR-217SCR21712scr00217
    • 2019-04-27
    195 min

    [CLUB-557]An Immoral Doctor Who Targets Girls In Uniform Is Giving Nipple Tweaking Medical Examinations 4

  • censoredbig titsCLUBhentai shinshi clubCLUB-557CLUB557club00557
    • 2019-03-08
    191 min

    [RIX-064]A Deliciously Juicy True Story That Really Happened To This Massage Therapist

  • marina yuzuki umi hyuga censoredbig titsRIXprestigerelaxation roomRIX-064RIX064118rix00064
    • 2019-03-01
    263 min

    [DNW-024]Peeping On A Shibuya Slick And Slippery Oil Massage Parlor 06

  • censoredcreampiebig titsDNWprestigedocument nowDNW-024DNW024118dnw00024
    • 2019-01-26
    195 min

    [CLUB-533]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 30

  • censoredcreampieCLUBhentai shinshi clubCLUB-533CLUB533club00533
    • 2019-01-11
    262 min

    [RIX-063]Creampie Raw Footage Orgasmic Peak Sex With A Beautiful And Happy Customer Who Is About To Get Married!! What Happened At The Bridal Massage Parlor

  • censoredcreampiebig titsRIXprestigerelaxation roomRIX-063RIX063118rix00063
    • 2018-12-21
    267 min

    [DNW-013]Peeping On A Shibuya Slick And Slippery Oil Massage Parlor 05

  • censoredcreampiebig titsDNWprestigedocument nowDNW-013DNW013118dnw00013
    • 2018-11-30
    233 min

    [CLUB-516]The Treatment room which the Female Teacher uses for Chiropratic Therapy 20

  • censoredCLUBhentai shinshi clubCLUB-516CLUB516club00516
    • 2018-11-02
    263 min

    [DNW-010]Peeping On A Shibuya Slick And Slippery Oil Massage Parlor 04

  • censoredcreampiebig titsDNWprestigedocument nowDNW-010DNW010118dnw00010
    • 2018-09-29
    168 min

    [CLUB-501]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 26

  • censoredCLUBhentai shinshi clubCLUB-501CLUB501club00501
    • 2018-09-29
    177 min

    [CLUB-502]I Learned That The Bad Girl Who Used To Bully Me Is Now A Beautiful Married Woman Running A Massage Parlor With Some Extra Sensual Services, So I Took Revenge By Having Creampie Sex With Her 18

  • censoredCLUBhentai shinshi clubCLUB-502CLUB502club00502
    • 2018-09-29
    234 min

    [CLUB-500]The Treatment room which the Female Teacher uses for Chiropratic Therapy 19

  • censoredCLUBhentai shinshi clubCLUB-500CLUB500club00500
    • 2018-09-29
    221 min

    [CLUB-503]We Went Picking Up Girls And Took Home This Friendly Pair Of Girls We Met At An Izakaya. If We Quietly Have Sex, Will Their Tight-Legged Friends In The Next Room Get Horny And Let Us Fuck Them Too？ 26

  • censoredCLUBhentai shinshi clubCLUB-503CLUB503club00503
    • 2018-09-14
    222 min

    [SCPX-300]How To Fuck Women For Sure! Married Woman Sexual Healing Massage

  • censoredcreampiebig titsSCPXk m produceupdatingSCPX-300SCPX300h-565scpx00300
    • 2018-03-24
    172 min

    [CLUB-462]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 20

  • censoredcreampieCLUBhentai shinshi kurabuupdatingCLUB-462CLUB462club00462
    • 2017-12-27
    153 min

    [CLUB-441]She Dated Her Husband For 12 Years Before They Got Married, But Now They're In A Sexless Marriage This Married Woman Nursery School Teacher Is Nip Slipping So Sexily That I Had To Give Her A Massage And She Transformed Into A Horny Bitc

  • censoredcreampieCLUBhentai shinshi clubCLUB-441CLUB441club00441
    • 2017-10-28
    234 min

    [CLUB-422]The Treatment room which the Female Teacher uses for Chiropratic Therapy 16

  • censoredCLUBhentai shinshi kurabuupdatingCLUB-422CLUB422club00422
    • 2017-04-27
    188 min

    [CLUB-379]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 9

  • censoredCLUBhentai shinshi clubCLUB-379CLUB379club00379
    • 2017-03-30
    222 min

    [CLUB-369]We Went Picking Up Girls And Took Home This Friendly Pair Of Girls We Met At An Izakaya. If We Quietly Have Sex, Will Their Tight-Legged Friends In The Next Room Get Horny And Let Us Fuck Them Too？ 15

  • censoredCLUBhentai shinshi clubCLUB-369CLUB369club00369
    • 2017-03-30
    235 min

    [CLUB-372]Specializing In Beautiful Office Ladies Located In Nakano Ward This Clinic Promises To Treat Their Patients' Sensual Spots And Guarantees Ecstatic Pissing Pleasure 3

  • censoredsquirtingCLUBhentai shinshi clubCLUB-372CLUB372club00372
    • 2017-03-30
    171 min

    [CLUB-371]All Peeping I Got Friendly With A Beautiful Married Woman Who Lived In My Building And So One Day I Brought Her To My Room And I Fucked Her Brains Out Chapter Four 8

  • censoredCLUBhentai shinshi clubCLUB-371CLUB371club00371
    • 2016-09-29
    232 min

    [CLUB-323]Specializing In Beautiful Office Ladies Located In Nakano Ward This Clinic Promises To Treat Their Patients' Sensual Spots And Guarantees Ecstatic Pissing Pleasure 2

  • censoredsquirtingCLUBhentai shinshi clubCLUB-323CLUB323club00323
    • 2016-09-29
    186 min

    [CLUB-290]We Went Picking Up Girls By Renting A Room Near The Famous Oo**** Station On The Yama** Line To Collect Ladies Who Missed Their Last Train Home We Targeted Drunk Office Ladies And Brought Them Home For All Night Fucking Until The First Trai

  • censoredCLUBhentai shinshi clubCLUB-290CLUB290club00290
    • 2016-08-27
    175 min

    [CLUB-284]We Went Picking Up Girls Around O**** Station, Which Is Famous For Men And Women Who Get Stranded After Missing The Last Train We've Got A Room Ready For Drunk Office Ladies So We Can Bring Them There For Sex

  • censoredCLUBhentai shinshi clubCLUB-284CLUB284club00284
    • 2016-05-29
    232 min

    [CLUB-292]Secretly Filmed Footage Of A Clean Female Japanese Masseuse Who Doesn't Do Happy Endings Getting Fucked After Being Shown A Black Dick 5

  • censoredbig titsCLUBhentai shinshi clubCLUB-292CLUB292club00292
    • 2016-04-27
    223 min

    [CLUB-281]Central Tokyo Office Lady's Special Spread Legged Treatment 8

  • censoredCLUBhentai shinshi clubCLUB-281CLUB281club00281
    • 2016-01-30
    212 min

    [CLUB-249]From A Famous Sports University In Japan A Chiropractic Clinic Run By A Sports Trainer Who Targets Only Competitive Swimmers 7

  • censoredCLUBhentai shinshi clubCLUB-249CLUB249club00249
    • 2015-10-29
    214 min

    [CLUB-223]Behind Closed Doors At A Shiatsu Massage Clinic Frequented By The Female Doctors Of Keio University Hospital 5

  • censoredCLUBhentai shinshi clubCLUB-223CLUB223club00223