uniform censored shame humiliation




FC2SPRDWANZSSNIWAAAFSDSSHMNAVSAMVSDHUNTBVENUADNCHRVATIDMEYDPPPDAWDSANGMEMMIAAROYD

2021-12-09
144 min

[NHDTB-609]Lewd Cafe Girl Lineup 3. Obedient Servers Are All Lined Up In A Row During Business Hours To Offer Lewd Service To Their Customers.

  • censoredNHDTBnatural highrafting maeshiroNHDTB-609NHDTB6091nhdtb00609
    • 2021-02-11
    118 min

    [FSDSS-167]Hottie Groped By Sticky Pervs, Mayoi Arisaka

  • arisaka mayoi censoredbig titssingle workFSDSSfalenocaptain eharafaleno starFSDSS-167FSDSS1671fsdss00167
    • 2020-08-23
    136 min

    [DBER-078]ULTRA HYPER JUICY AWABI A Cruelly And Publicly Shamed Celebrity Film-01: A Tragic Female Documentary!! A New Face Announcer Gets Shamed While On The Air Noa Kosaka

  • kosaka censoreduniformbdsmDBERbabyentertainmentkikubonred babeDBER-078DBER078dber00078
    • 2020-06-14
    155 min

    [OYC-327]This Pushover Babe Is Selling Lactic Acid D***ks And Is Always Getting Fucked At The Offices Of Her Customers Every Day.

  • censoreduniformOYCoyashoku.companysleggerhhh groupOYC-327OYC327oyc00327
    • 2020-06-06
    184 min

    [AP-775]Women Get Sexually Harassed By Their Bosses Every Day - At First It Was Unwanted Attention, But Soon They Wait In Anticipation Of Having Their Nipples Caressed

  • censoreduniformAPapachemasanorihhh groupAP-775AP775ap00775
    • 2020-04-16
    120 min

    [SSNI-766]Beautiful Y********l In Uniform Rough Sex G*******g Most Popular Girl In School Gets Fucked By All Of Her Male Classmates Hinari Yoshioka

  • hiyori yoshioka censoreduniformbeautiful girlSSNIs1 no 1 stylegoemonSSNI-766SSNI766ssni00766
    • 2020-03-05
    235 min

    [AP-750]Creampie Counterattack On A High School Bully!

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-750AP750ap00750
    • 2020-02-01
    151 min

    [SSNI-694]Big Tits S*********l in Uniform Fucked In Total Bondage, Hotaru Nogi

  • nogi firefly censoredbig titsuniformSSNIs1 no 1 stylejo styleSSNI-694SSNI694ssni00694
    • 2019-12-28
    198 min

    [OYC-298]This Weak-Willed Sch**lgirl Who Works Part-Time At A Food Processing Plant Is Getting Treated To Sexual Harassment By The Male Workers, And It Was All Caught On Video, From Start To Finish

  • censoreduniformschoolgirlOYCoyashoku.companygarumahhh groupOYC-298OYC298oyc00298
    • 2019-12-28
    197 min

    [AP-727]This Prim And Proper And Weak-Willed Librarian In Glasses Is Unable To Fight Back Against The Sexual Harassment She Gets From The Male S*****ts And The Male Teacher Assholes, And Simply Just Puts Up With It, Day After Day After Day. And After

  • censoredschoolgirlAPapachemasanorihhh groupAP-727AP727ap00727
    • 2019-12-20
    149 min

    [DBER-050]The Fuck Research Center III JUDAS FINAL STAGE Story-1 The Fairy Moon Descends Into Demonic Darkness A Fiery Woman Is Demolished In Secret Sadness Yuri Sasahara

  • yuri sasahara censoreduniformsingle workDBERbabyentertainmentkikubonred babeDBER-050DBER050dber00050
    • 2019-12-14
    196 min

    [OYC-295]Innocent High S*********ls In Knee-High Socks Get Broken In By Their Teachers

  • censoredschoolgirlOYCoyashoku.companyartesiahhh groupOYC-295OYC295oyc00295
    • 2019-11-14
    235 min

    [AP-715]Schoolgirl "Total Domain" Prank Body Measurement

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-715AP715ap00715
    • 2019-11-14
    193 min

    [OYC-288]Lunch Center Female Staff Sexual Harassment Health Exam

  • censoreduniformOYCoyashoku.companysleggerhhh groupOYC-288OYC288oyc00288
    • 2019-10-03
    216 min

    [OYC-279]A Weak-Willed Nurse Who Endures Dismal And Soul-Crushing Sexual Harassment On A Daily Basis, And Just Continues To Take It

  • censoredcreampieuniformOYCoyashoku.companymatildahhh groupOYC-279OYC279oyc00279
    • 2019-07-13
    147 min

    [SSNI-524]Breaking In A Female Student In Uniform. Continuously Fucked By Middle-Aged Fanatics... Mako Iga

  • iga mako censoredschoolgirlsingle workSSNIs1 no 1 styleamazing meatSSNI-524SSNI524ssni00524
    • 2019-06-15
    218 min

    [AP-666]Nurse Is In On It So She Can't Run Away! Schoolgirl Sexual Harassment Health Exam Forced Nipple Cumming Molestation

  • censoredcreampieschoolgirlAPapachemasanorihhh groupAP-666AP666ap00666
    • 2019-05-20
    133 min

    [DART-003]The Woman From The Special Security Force ~The Cruel Abuse Of The Proud Artemis's Body~ Episode-3. Her Impregnable Defense Is Torn Down And Her Body Gives In To Pleasure. The Humiliation Gives Off A Bewitching Scent. Ririka

  • ririka censoreduniformbdsmDARTbabyentertainmentkoolongbaby entertainmentDART-003DART003dart00003
    • 2019-04-21
    145 min

    [DPGD-003]SUPER JUICY AWABI GODDESS No.3. A Beautiful Girl Is Tortured. Sacred Humiliation Of A Goddess With A Dirty Body. Maina Miura

  • mai minamata censoredschoolgirlDPGDbabyentertainmentkikubonpinky awabiDPGD-003DPGD003dpgd00003
    • 2019-04-04
    189 min

    [OYC-244]This Girl From My Class Who's Always Bullying Me Has Finally Cum To My House! So I Planted Hidden Cameras And Recorded The Whole Incident. When I Told Her That I Had Proof That She Was Bullying Me, Her Attitude Suddenly Changed... And No

  • censoredschoolgirlOYCoyashoku.companytoguro sistershhh groupOYC-244OYC244oyc00244
    • 2019-03-16
    121 min

    [GDHH-144]I Lock My Bratty Little Sister In A "Legspread"!! And I Fuck Her While Keeping Her In The "Legspread" Hold! My Little Sister Used To Be Really Close To Me But Now That She Thinks She's All Grown Up, She's Always Com

  • censoredschoolgirlsisterGDHHgolden timekiteretsuhhh groupGDHH-144GDHH144gdhh00144
    • 2019-02-16
    162 min

    [AP-633]Super Sensitive! Premenstrual Schoolgirls. Nipple-Twisting Sexual Harassment During A Physical Exam. "Every Girl Gets A Creampie" Version

  • censoredcreampieschoolgirlAPapachekuniokahhh groupAP-633AP633ap00633
    • 2019-02-10
    149 min

    [DJUD-120]Female Torture Research. THE THIRD JUDAS Episode-20. Her Pussy Is Driven Crazy By The Distant Memory Of Torture. The Sleeping Lioness Is Awakened By Intense Orgasms. Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoreduniformmature womanDJUDbabyentertainmentkoolongbaby entertainmentDJUD-120DJUD120djud00120
    • 2019-01-17
    192 min

    [OYC-231]A Weak-Willed Big Tits Office Lady Becomes The Prey Of A Sexual Harassment Examination And Is Unable To Resist While She Cums With Teary Eyes!

  • censoreduniformOYCoyashoku.companytoguro sistershhh groupOYC-231OYC231oyc00231
    • 2018-12-30
    148 min

    [DART-002]The Female Bodyguard ~Proud Artemis's Ruthless Carnal Punishment~ Episode 2: The Woman With The Secret Fist Technique Cums To Save The Day Satomi Suzuki

  • satomi suzuki censoreduniformmature womanDARTbabyentertainmentkoolongbaby entertainmentDART-002DART002dart00002
    • 2018-11-17
    232 min

    [ATOM-353]Squeezing Their Tits! Rubbing Their Asses! Schoolgirls Only! Guess Which Molester Touched You! "Who Is The Molester" Quiz

  • censoredschoolgirlATOMatomwhatta gianthhh groupATOM-353ATOM353atom00353
    • 2018-11-04
    133 min

    [DART-001]The Female Special Guard ~The Merciless Violation Of The Proud Artemis~ Episode-1. The Crimson Sniper, The Tormented Doll's Humiliation. Rika Mari

  • mari rika censoreduniformDARTbabyentertainmentkoolongbaby entertainmentDART-001DART001dart00001
    • 2018-09-09
    135 min

    [DBBA-002]THE BBA DYNAMITE ORGASM Humiliated By A Mature Woman Episode 2: Sentenced To Shaming!! Department of Investigation Main Branch Mariko's Complete Mature Woman Body Taking You To Heaven Mari Asou

  • mari aso censoredmature womanDBBAbabyentertainmentkoolongbaby entertainmentDBBA-002DBBA002dbba00002
    • 2018-05-21
    145 min

    [DBER-006]The Orgasmic All Hole Torture Investigator VOL.1 This Officer Of Justice Had Her Body Ravaged With Merciless Lust Karen Sakisaka

  • sakisaka hanakoi censoreduniformDBERbabyentertainmentkikubonred babeDBER-006DBER006dber00006
    • 2018-03-04
    170 min

    [GDHH-094]You've Got To Be Kidding!？ Why Is This Lady Buck Naked!？ When They Mixed Up My Order, I Called The Company To Complain, So They Sent This Ultra Cute Girl To Handle y Claim! But No Matter How Much I Complained All She Did Was Apologize,

  • censoreduniformGDHHgolden timekorosukeGDHH-094GDHH094gdhh00094
    • 2018-02-02
    121 min

    [DIC-006]Suzume No.3 Rina/Mai

  • censoredschoolgirlamateurDICdickyDIC-006DIC00636dic00006
    • 2017-04-03
    243 min

    [HUNTA-286]You Fuck That Loser! A Scary Classmate Is Giving Orders! I'm A Loser And Everyone In Class Hates Me, And My House Is Always Being Taken Over By My Classmate Bitches, And They're Always Fucking And Using It Like A Hotel But When The

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-286HUNTA286hunta00286
    • 2015-12-24
    242 min

    [NHDTA-761]Full Service Blushing Sluts 12 Conveyor Belt Sushi, Eel Restaurant, Tanning Salon, Maid Cafe

  • censoreduniformNHDTAnatural highjanken kotamaNHDTA-761NHDTA7611nhdta00761
    • 2015-06-06
    240 min

    [NHDTA-680]Don't Make A Sound 15

  • censoredschoolgirlNHDTAnatural highitaka smithlin powderNHDTA-680NHDTA6801nhdta00680
    • 2012-11-29
    118 min

    [MIAD-592]Rejection And Resistance Is Not Acceptable. Notice To Be In Charge Of Sex

  • maeda hina kokura momo censoreduniformMIADmoody sgory matsudamoodyz acidMIAD-592MIAD592miad00592